KEGG   Mus musculus (mouse): 24099Help
Entry
24099             CDS       T01002                                 

Gene name
Tnfsf13b, BAFF, BLyS, D8Ertd387e, TALL-1, TALL1, THANK, TNFSF20, Tnlg7a, zTNF4
Definition
(RefSeq) tumor necrosis factor (ligand) superfamily, member 13b
  KO
K05476  tumor necrosis factor ligand superfamily member 13B
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04064  NF-kappa B signaling pathway
mmu04672  Intestinal immune network for IgA production
mmu05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    24099 (Tnfsf13b)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    24099 (Tnfsf13b)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    24099 (Tnfsf13b)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    24099 (Tnfsf13b)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    24099 (Tnfsf13b)
   04090 CD molecules [BR:mmu04090]
    24099 (Tnfsf13b)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Tumor necrosis fators
   24099 (Tnfsf13b)
CD molecules [BR:mmu04090]
 Proteins
  24099 (Tnfsf13b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNF
Motif
Other DBs
NCBI-GeneID: 24099
NCBI-ProteinID: NP_296371
MGI: 1344376
Ensembl: ENSMUSG00000031497
Vega: OTTMUSG00000059081
UniProt: Q9WU72 Q3KP92
LinkDB All DBs
Position
8 A1.1; 8 4.55 cM
AA seq 309 aa AA seqDB search
MDESAKTLPPPCLCFCSEKGEDMKVGYDPITPQKEEGAWFGICRDGRLLAATLLLALLSS
SFTAMSLYQLAALQADLMNLRMELQSYRGSATPAAAGAPELTAGVKLLTPAAPRPHNSSR
GHRNRRAFQGPEETEQDVDLSAPPAPCLPGCRHSQHDDNGMNLRNIIQDCLQLIADSDTP
TIRKGTYTFVPWLLSFKRGNALEEKENKIVVRQTGYFFIYSQVLYTDPIFAMGHVIQRKK
VHVFGDELSLVTLFRCIQNMPKTLPNNSCYSAGIARLEEGDEIQLAIPRENAQISRNGDD
TFFGALKLL
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggatgagtctgcaaagaccctgccaccaccgtgcctctgtttttgctccgagaaagga
gaagatatgaaagtgggatatgatcccatcactccgcagaaggaggagggtgcctggttt
gggatctgcagggatggaaggctgctggctgctaccctcctgctggccctgttgtccagc
agtttcacagcgatgtccttgtaccagttggctgccttgcaagcagacctgatgaacctg
cgcatggagctgcagagctaccgaggttcagcaacaccagccgccgcgggtgctccagag
ttgaccgctggagtcaaactcctgacaccggcagctcctcgaccccacaactccagccgc
ggccacaggaacagacgcgctttccagggaccagaggaaacagaacaagatgtagacctc
tcagctcctcctgcaccatgcctgcctggatgccgccattctcaacatgatgataatgga
atgaacctcagaaacatcattcaagactgtctgcagctgattgcagacagcgacacgccg
actatacgaaaaggaacttacacatttgttccatggcttctcagctttaaaagaggaaat
gccttggaggagaaagagaacaaaatagtggtgaggcaaacaggctatttcttcatctac
agccaggttctatacacggaccccatctttgctatgggtcatgtcatccagaggaagaaa
gtacacgtctttggggacgagctgagcctggtgaccctgttccgatgtattcagaatatg
cccaaaacactgcccaacaattcctgctactcggctggcatcgcgaggctggaagaagga
gatgagattcagcttgcaattcctcgggagaatgcacagatttcacgcaacggagacgac
accttctttggtgccctaaaactgctgtaa

DBGET integrated database retrieval system