KEGG   Mus musculus (mouse): 26395Help
Entry
26395             CDS       T01002                                 

Gene name
Map2k1, MAPKK1, MEKK1, Mek1, Prkmk1
Definition
(RefSeq) mitogen-activated protein kinase kinase 1
  KO
K04368  mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu01522  Endocrine resistance
mmu04010  MAPK signaling pathway
mmu04012  ErbB signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04022  cGMP-PKG signaling pathway
mmu04024  cAMP signaling pathway
mmu04062  Chemokine signaling pathway
mmu04066  HIF-1 signaling pathway
mmu04068  FoxO signaling pathway
mmu04071  Sphingolipid signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04114  Oocyte meiosis
mmu04140  Autophagy - animal
mmu04150  mTOR signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04210  Apoptosis
mmu04218  Cellular senescence
mmu04270  Vascular smooth muscle contraction
mmu04370  VEGF signaling pathway
mmu04371  Apelin signaling pathway
mmu04380  Osteoclast differentiation
mmu04510  Focal adhesion
mmu04540  Gap junction
mmu04550  Signaling pathways regulating pluripotency of stem cells
mmu04620  Toll-like receptor signaling pathway
mmu04650  Natural killer cell mediated cytotoxicity
mmu04660  T cell receptor signaling pathway
mmu04662  B cell receptor signaling pathway
mmu04664  Fc epsilon RI signaling pathway
mmu04666  Fc gamma R-mediated phagocytosis
mmu04668  TNF signaling pathway
mmu04720  Long-term potentiation
mmu04722  Neurotrophin signaling pathway
mmu04725  Cholinergic synapse
mmu04726  Serotonergic synapse
mmu04730  Long-term depression
mmu04810  Regulation of actin cytoskeleton
mmu04910  Insulin signaling pathway
mmu04912  GnRH signaling pathway
mmu04914  Progesterone-mediated oocyte maturation
mmu04915  Estrogen signaling pathway
mmu04916  Melanogenesis
mmu04917  Prolactin signaling pathway
mmu04919  Thyroid hormone signaling pathway
mmu04921  Oxytocin signaling pathway
mmu04926  Relaxin signaling pathway
mmu04928  Parathyroid hormone synthesis, secretion and action
mmu04934  Cushing syndrome
mmu05020  Prion diseases
mmu05034  Alcoholism
mmu05135  Yersinia infection
mmu05160  Hepatitis C
mmu05161  Hepatitis B
mmu05163  Human cytomegalovirus infection
mmu05164  Influenza A
mmu05165  Human papillomavirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05200  Pathways in cancer
mmu05205  Proteoglycans in cancer
mmu05206  MicroRNAs in cancer
mmu05210  Colorectal cancer
mmu05211  Renal cell carcinoma
mmu05212  Pancreatic cancer
mmu05213  Endometrial cancer
mmu05214  Glioma
mmu05215  Prostate cancer
mmu05216  Thyroid cancer
mmu05218  Melanoma
mmu05219  Bladder cancer
mmu05220  Chronic myeloid leukemia
mmu05221  Acute myeloid leukemia
mmu05223  Non-small cell lung cancer
mmu05224  Breast cancer
mmu05225  Hepatocellular carcinoma
mmu05226  Gastric cancer
mmu05230  Central carbon metabolism in cancer
mmu05231  Choline metabolism in cancer
mmu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    26395 (Map2k1)
   04015 Rap1 signaling pathway
    26395 (Map2k1)
   04010 MAPK signaling pathway
    26395 (Map2k1)
   04012 ErbB signaling pathway
    26395 (Map2k1)
   04370 VEGF signaling pathway
    26395 (Map2k1)
   04371 Apelin signaling pathway
    26395 (Map2k1)
   04668 TNF signaling pathway
    26395 (Map2k1)
   04066 HIF-1 signaling pathway
    26395 (Map2k1)
   04068 FoxO signaling pathway
    26395 (Map2k1)
   04072 Phospholipase D signaling pathway
    26395 (Map2k1)
   04071 Sphingolipid signaling pathway
    26395 (Map2k1)
   04024 cAMP signaling pathway
    26395 (Map2k1)
   04022 cGMP-PKG signaling pathway
    26395 (Map2k1)
   04151 PI3K-Akt signaling pathway
    26395 (Map2k1)
   04150 mTOR signaling pathway
    26395 (Map2k1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    26395 (Map2k1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    26395 (Map2k1)
   04210 Apoptosis
    26395 (Map2k1)
   04218 Cellular senescence
    26395 (Map2k1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    26395 (Map2k1)
   04540 Gap junction
    26395 (Map2k1)
   04550 Signaling pathways regulating pluripotency of stem cells
    26395 (Map2k1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    26395 (Map2k1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    26395 (Map2k1)
   04650 Natural killer cell mediated cytotoxicity
    26395 (Map2k1)
   04660 T cell receptor signaling pathway
    26395 (Map2k1)
   04662 B cell receptor signaling pathway
    26395 (Map2k1)
   04664 Fc epsilon RI signaling pathway
    26395 (Map2k1)
   04666 Fc gamma R-mediated phagocytosis
    26395 (Map2k1)
   04062 Chemokine signaling pathway
    26395 (Map2k1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    26395 (Map2k1)
   04912 GnRH signaling pathway
    26395 (Map2k1)
   04915 Estrogen signaling pathway
    26395 (Map2k1)
   04914 Progesterone-mediated oocyte maturation
    26395 (Map2k1)
   04917 Prolactin signaling pathway
    26395 (Map2k1)
   04921 Oxytocin signaling pathway
    26395 (Map2k1)
   04926 Relaxin signaling pathway
    26395 (Map2k1)
   04919 Thyroid hormone signaling pathway
    26395 (Map2k1)
   04928 Parathyroid hormone synthesis, secretion and action
    26395 (Map2k1)
   04916 Melanogenesis
    26395 (Map2k1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    26395 (Map2k1)
  09156 Nervous system
   04725 Cholinergic synapse
    26395 (Map2k1)
   04726 Serotonergic synapse
    26395 (Map2k1)
   04720 Long-term potentiation
    26395 (Map2k1)
   04730 Long-term depression
    26395 (Map2k1)
   04722 Neurotrophin signaling pathway
    26395 (Map2k1)
  09158 Development
   04380 Osteoclast differentiation
    26395 (Map2k1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    26395 (Map2k1)
   05206 MicroRNAs in cancer
    26395 (Map2k1)
   05205 Proteoglycans in cancer
    26395 (Map2k1)
   05230 Central carbon metabolism in cancer
    26395 (Map2k1)
   05231 Choline metabolism in cancer
    26395 (Map2k1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    26395 (Map2k1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    26395 (Map2k1)
   05212 Pancreatic cancer
    26395 (Map2k1)
   05225 Hepatocellular carcinoma
    26395 (Map2k1)
   05226 Gastric cancer
    26395 (Map2k1)
   05214 Glioma
    26395 (Map2k1)
   05216 Thyroid cancer
    26395 (Map2k1)
   05221 Acute myeloid leukemia
    26395 (Map2k1)
   05220 Chronic myeloid leukemia
    26395 (Map2k1)
   05218 Melanoma
    26395 (Map2k1)
   05211 Renal cell carcinoma
    26395 (Map2k1)
   05219 Bladder cancer
    26395 (Map2k1)
   05215 Prostate cancer
    26395 (Map2k1)
   05213 Endometrial cancer
    26395 (Map2k1)
   05224 Breast cancer
    26395 (Map2k1)
   05223 Non-small cell lung cancer
    26395 (Map2k1)
  09164 Neurodegenerative disease
   05020 Prion diseases
    26395 (Map2k1)
  09165 Substance dependence
   05034 Alcoholism
    26395 (Map2k1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    26395 (Map2k1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    26395 (Map2k1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    26395 (Map2k1)
   05170 Human immunodeficiency virus 1 infection
    26395 (Map2k1)
   05164 Influenza A
    26395 (Map2k1)
   05161 Hepatitis B
    26395 (Map2k1)
   05160 Hepatitis C
    26395 (Map2k1)
   05163 Human cytomegalovirus infection
    26395 (Map2k1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    26395 (Map2k1)
   05165 Human papillomavirus infection
    26395 (Map2k1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    26395 (Map2k1)
   01522 Endocrine resistance
    26395 (Map2k1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    26395 (Map2k1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     26395 (Map2k1)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: STE group
  STE7 family
   26395 (Map2k1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal Haspin_kinase Seadorna_VP7 Kinase-like NAD_binding_6
Motif
Other DBs
NCBI-GeneID: 26395
NCBI-ProteinID: NP_032953
MGI: 1346866
Ensembl: ENSMUSG00000004936
Vega: OTTMUSG00000016895
UniProt: P31938 Q3TMJ8
LinkDB All DBs
Position
9 C; 9 34.55 cM
AA seq 393 aa AA seqDB search
MPKKKPTPIQLNPAPDGSAVNGTSSAETNLEALQKKLEELELDEQQRKRLEAFLTQKQKV
GELKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQVLHE
CNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYL
REKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHY
SVQSDIWSMGLSLVEMAVGRYPIPPPDAKELELLFGCHVEGDAAETPPRPRTPGRPLSSY
GMDSRPPMAIFELLDYIVNEPPPKLPSGVFSLEFQDFVNKCLIKNPAERADLKQLMVHAF
IKRSDAEEVDFAGWLCSTIGLNQPSTPTHAASI
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgcccaagaagaagccgacgcccatccagctgaacccggcccccgatggctcggcggtt
aacgggaccagctcggccgagaccaacctggaggccttgcagaagaagctggaggagctg
gagcttgacgagcagcagcggaagcggctcgaggcctttctgacgcagaagcagaaggtg
ggggaactgaaggatgatgactttgagaagatcagcgaactgggagctggcaacggtgga
gtggtcttcaaggtctcccacaagccatctggcctggttatggctagaaagctgatccac
ctggagatcaaacccgcaatccggaaccagatcatccgggagctgcaggtactgcacgag
tgcaactccccgtacatcgtgggcttctacggggccttctacagcgacggcgagatcagc
atctgcatggagcacatggatggtgggtccttggatcaagttctgaagaaagctggaaga
attcctgagcaaattttaggaaaagttagcattgctgtgataaaaggcctgacctatctt
cgggagaagcacaagattatgcacagagatgtcaagccatccaacattctagtgaactca
cgtggggagatcaaactctgtgattttggggtcagcgggcagctaattgactctatggcc
aactccttcgtgggcacgagatcctacatgtcgcctgagagactccaggggactcactac
tctgtgcagtcggacatctggagcatggggctctctctggtggagatggcagttgggaga
taccccattcctcctcctgatgccaaggagctggagctactgtttggatgccatgtggaa
ggagacgcagccgaaacaccacccaggccaaggacccctgggaggcctctcagctcatat
ggaatggacagccgacctcccatggcaatttttgagttgttggattacattgtcaatgag
cctcctccaaaactgcccagtggagtattcagtctggagtttcaggattttgtgaataaa
tgcttaataaagaaccctgcagagagagcagatctgaagcagctcatggtacatgctttc
atcaaaagatctgacgccgaggaggtagacttcgcaggctggctctgctccaccattggg
cttaaccagcccagcacaccaacccacgctgccagcatctga

KEGG   Mus musculus (mouse): 26396Help
Entry
26396             CDS       T01002                                 

Gene name
Map2k2, AA589381, MEK2, MK2, Prkmk2
Definition
(RefSeq) mitogen-activated protein kinase kinase 2
  KO
K04369  mitogen-activated protein kinase kinase 2 [EC:2.7.12.2]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu01522  Endocrine resistance
mmu04010  MAPK signaling pathway
mmu04012  ErbB signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04022  cGMP-PKG signaling pathway
mmu04024  cAMP signaling pathway
mmu04066  HIF-1 signaling pathway
mmu04068  FoxO signaling pathway
mmu04071  Sphingolipid signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04140  Autophagy - animal
mmu04150  mTOR signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04210  Apoptosis
mmu04218  Cellular senescence
mmu04270  Vascular smooth muscle contraction
mmu04370  VEGF signaling pathway
mmu04371  Apelin signaling pathway
mmu04540  Gap junction
mmu04550  Signaling pathways regulating pluripotency of stem cells
mmu04620  Toll-like receptor signaling pathway
mmu04650  Natural killer cell mediated cytotoxicity
mmu04660  T cell receptor signaling pathway
mmu04662  B cell receptor signaling pathway
mmu04664  Fc epsilon RI signaling pathway
mmu04720  Long-term potentiation
mmu04722  Neurotrophin signaling pathway
mmu04730  Long-term depression
mmu04810  Regulation of actin cytoskeleton
mmu04910  Insulin signaling pathway
mmu04912  GnRH signaling pathway
mmu04915  Estrogen signaling pathway
mmu04916  Melanogenesis
mmu04917  Prolactin signaling pathway
mmu04919  Thyroid hormone signaling pathway
mmu04921  Oxytocin signaling pathway
mmu04926  Relaxin signaling pathway
mmu04934  Cushing syndrome
mmu05020  Prion diseases
mmu05135  Yersinia infection
mmu05160  Hepatitis C
mmu05161  Hepatitis B
mmu05163  Human cytomegalovirus infection
mmu05164  Influenza A
mmu05165  Human papillomavirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05200  Pathways in cancer
mmu05205  Proteoglycans in cancer
mmu05206  MicroRNAs in cancer
mmu05210  Colorectal cancer
mmu05211  Renal cell carcinoma
mmu05213  Endometrial cancer
mmu05214  Glioma
mmu05215  Prostate cancer
mmu05216  Thyroid cancer
mmu05218  Melanoma
mmu05219  Bladder cancer
mmu05220  Chronic myeloid leukemia
mmu05221  Acute myeloid leukemia
mmu05223  Non-small cell lung cancer
mmu05224  Breast cancer
mmu05225  Hepatocellular carcinoma
mmu05226  Gastric cancer
mmu05230  Central carbon metabolism in cancer
mmu05231  Choline metabolism in cancer
mmu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    26396 (Map2k2)
   04015 Rap1 signaling pathway
    26396 (Map2k2)
   04010 MAPK signaling pathway
    26396 (Map2k2)
   04012 ErbB signaling pathway
    26396 (Map2k2)
   04370 VEGF signaling pathway
    26396 (Map2k2)
   04371 Apelin signaling pathway
    26396 (Map2k2)
   04066 HIF-1 signaling pathway
    26396 (Map2k2)
   04068 FoxO signaling pathway
    26396 (Map2k2)
   04072 Phospholipase D signaling pathway
    26396 (Map2k2)
   04071 Sphingolipid signaling pathway
    26396 (Map2k2)
   04024 cAMP signaling pathway
    26396 (Map2k2)
   04022 cGMP-PKG signaling pathway
    26396 (Map2k2)
   04151 PI3K-Akt signaling pathway
    26396 (Map2k2)
   04150 mTOR signaling pathway
    26396 (Map2k2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    26396 (Map2k2)
  09143 Cell growth and death
   04210 Apoptosis
    26396 (Map2k2)
   04218 Cellular senescence
    26396 (Map2k2)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    26396 (Map2k2)
   04550 Signaling pathways regulating pluripotency of stem cells
    26396 (Map2k2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    26396 (Map2k2)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    26396 (Map2k2)
   04650 Natural killer cell mediated cytotoxicity
    26396 (Map2k2)
   04660 T cell receptor signaling pathway
    26396 (Map2k2)
   04662 B cell receptor signaling pathway
    26396 (Map2k2)
   04664 Fc epsilon RI signaling pathway
    26396 (Map2k2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    26396 (Map2k2)
   04912 GnRH signaling pathway
    26396 (Map2k2)
   04915 Estrogen signaling pathway
    26396 (Map2k2)
   04917 Prolactin signaling pathway
    26396 (Map2k2)
   04921 Oxytocin signaling pathway
    26396 (Map2k2)
   04926 Relaxin signaling pathway
    26396 (Map2k2)
   04919 Thyroid hormone signaling pathway
    26396 (Map2k2)
   04916 Melanogenesis
    26396 (Map2k2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    26396 (Map2k2)
  09156 Nervous system
   04720 Long-term potentiation
    26396 (Map2k2)
   04730 Long-term depression
    26396 (Map2k2)
   04722 Neurotrophin signaling pathway
    26396 (Map2k2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    26396 (Map2k2)
   05206 MicroRNAs in cancer
    26396 (Map2k2)
   05205 Proteoglycans in cancer
    26396 (Map2k2)
   05230 Central carbon metabolism in cancer
    26396 (Map2k2)
   05231 Choline metabolism in cancer
    26396 (Map2k2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    26396 (Map2k2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    26396 (Map2k2)
   05225 Hepatocellular carcinoma
    26396 (Map2k2)
   05226 Gastric cancer
    26396 (Map2k2)
   05214 Glioma
    26396 (Map2k2)
   05216 Thyroid cancer
    26396 (Map2k2)
   05221 Acute myeloid leukemia
    26396 (Map2k2)
   05220 Chronic myeloid leukemia
    26396 (Map2k2)
   05218 Melanoma
    26396 (Map2k2)
   05211 Renal cell carcinoma
    26396 (Map2k2)
   05219 Bladder cancer
    26396 (Map2k2)
   05215 Prostate cancer
    26396 (Map2k2)
   05213 Endometrial cancer
    26396 (Map2k2)
   05224 Breast cancer
    26396 (Map2k2)
   05223 Non-small cell lung cancer
    26396 (Map2k2)
  09164 Neurodegenerative disease
   05020 Prion diseases
    26396 (Map2k2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    26396 (Map2k2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    26396 (Map2k2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    26396 (Map2k2)
   05170 Human immunodeficiency virus 1 infection
    26396 (Map2k2)
   05164 Influenza A
    26396 (Map2k2)
   05161 Hepatitis B
    26396 (Map2k2)
   05160 Hepatitis C
    26396 (Map2k2)
   05163 Human cytomegalovirus infection
    26396 (Map2k2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    26396 (Map2k2)
   05165 Human papillomavirus infection
    26396 (Map2k2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    26396 (Map2k2)
   01522 Endocrine resistance
    26396 (Map2k2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    26396 (Map2k2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     26396 (Map2k2)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: STE group
  STE7 family
   26396 (Map2k2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal Haspin_kinase Kinase-like APH Seadorna_VP7 Kdo
Motif
Other DBs
NCBI-GeneID: 26396
NCBI-ProteinID: NP_075627
MGI: 1346867
Ensembl: ENSMUSG00000035027
Vega: OTTMUSG00000016975
UniProt: Q63932 Q8CB46
LinkDB All DBs
Position
10 C1; 10 39.72 cM
AA seq 401 aa AA seqDB search
MLARRKPVLPALTINPTIAEGPSPTSEGASEANLVDLQKKLEELDLDEQQRKRLEAFLTQ
KAKVGELKDDDFERISELGAGNGGVVTKARHRPSGLIMARKLIHLEIKPAVRNQIIRELQ
VLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKEAKRIPEDILGKVSIAVLRG
LAYLREKHQIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQ
GTHYSVQSDIWSMGLSLVELAIGRYPIPPPDAKELEASFGRPVVDGADGEPHSVSPRPRP
PGRPISVGHGMDSRPAMAIFELLDYIVNEPPPKLPSGVFSSDFQEFVNKCLIKNPAERAD
LKLLMNHAFIKRSEGEEVDFAGWLCRTLRLKQPSTPTRTAV
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgctggcccggaggaagccggtgttaccggcactcactatcaaccctaccatcgccgag
ggcccgtcccccaccagcgagggcgcctctgaggcaaacctggtggacctccagaagaag
ctggaagagctggacctggatgagcagcaaaggaagcggctggaggccttccttacccag
aaggctaaggtcggtgagctcaaggacgacgactttgagaggatctcagagctgggtgcc
ggcaatggcggagtggtcaccaaggcccggcataggccgtcaggcctcatcatggccaga
aagctgatccacctggagatcaaaccggccgtgcgcaaccagatcatccgggagctgcag
gtgctgcacgagtgcaactcgccctacatcgtgggcttctatggggccttctacagcgac
ggcgagatcagcatctgcatggagcacatggatggtggctcactggaccaggtactgaag
gaggccaagcggattcctgaagacatcttggggaaggtcagcattgcggtgctccggggc
ctggcctacctccgagagaagcaccagatcatgcacagagatgtgaagccctccaacatc
ctggtgaactctcgcggggagattaagctgtgtgacttcggggtgagcggccagctgatc
gactccatggccaactcgtttgtagggacgcgctcctacatgtccccagagcggctgcag
ggcacccactactctgtgcagtcggacatctggagcatggggctgtcgctggtggagctg
gccatcgggaggtatcccattcccccacctgatgccaaggaactagaggccagctttggc
cggcctgtggtggacggggcagacggagaaccccatagtgtctccccgaggcccaggccc
cctggacgccccatcagtgtaggtcatgggatggacagccgaccggccatggccatcttt
gagctgctggactacatagtgaacgagccacctcccaagctgcccagtggtgtgttcagc
tcagacttccaggagtttgtgaataaatgtctcattaagaacccagcagagcgagcagat
ctgaagctgctgatgaaccacgccttcatcaagcgctctgagggggaggaagtggacttc
gccggctggctgtgcagaaccctgcggctgaagcagcccagcacacccacgcggactgca
gtgtga

DBGET integrated database retrieval system