KEGG   Mus musculus (mouse): 26408Help
Entry
26408             CDS       T01002                                 

Gene name
Map3k5, 7420452D20Rik, ASK, ASK1, MAPKKK5, Mekk5
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 5
  KO
K04426  mitogen-activated protein kinase kinase kinase 5 [EC:2.7.11.25]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01524  Platinum drug resistance
mmu04010  MAPK signaling pathway
mmu04071  Sphingolipid signaling pathway
mmu04141  Protein processing in endoplasmic reticulum
mmu04210  Apoptosis
mmu04530  Tight junction
mmu04668  TNF signaling pathway
mmu04714  Thermogenesis
mmu04722  Neurotrophin signaling pathway
mmu04932  Non-alcoholic fatty liver disease (NAFLD)
mmu05014  Amyotrophic lateral sclerosis (ALS)
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    26408 (Map3k5)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    26408 (Map3k5)
   04668 TNF signaling pathway
    26408 (Map3k5)
   04071 Sphingolipid signaling pathway
    26408 (Map3k5)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    26408 (Map3k5)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    26408 (Map3k5)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    26408 (Map3k5)
  09159 Environmental adaptation
   04714 Thermogenesis
    26408 (Map3k5)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis (ALS)
    26408 (Map3k5)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    26408 (Map3k5)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    26408 (Map3k5)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    26408 (Map3k5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    26408 (Map3k5)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     26408 (Map3k5)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: STE group
  STE11 family
   26408 (Map3k5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF4071 Pkinase Pkinase_Tyr FPP Pkinase_fungal Kinase-like
Motif
Other DBs
NCBI-GeneID: 26408
NCBI-ProteinID: NP_032606
MGI: 1346876
Ensembl: ENSMUSG00000071369
Vega: OTTMUSG00000031050
UniProt: O35099
LinkDB All DBs
Position
10; 10 A3
AA seq 1380 aa AA seqDB search
MGTEAGEGITFSVPPFASVGFCTIPEGGSCRRGGGAATAAEGEPSLQPLLVPPPPPPPGS
FWNVESAAAPGTSCPTTAPGSSATRGRGNSGSGGGRRTTVAYVINEASQGQLVVAESEAL
QSLREACEAVGATLETLHFGKLDFGETAVLDRFYNADIAVVEMSDAFRQPSLFYHLGVRE
SFSMANNIILYCDTNSDSLQSLKEIICQKNTVCTGNYTFIPYMVTPHNKVYCCDSSFMKG
LTELMQPNFELLLGPICLPLVDRFVQLLKVAQASSSQYFRESILSDIRKARNLYTGKELA
AELARIRQRVDNIEVLTADIVINLLLSYRDIQDYDSIVKLVETLEKLPTFDLASHHHVKF
HYAFALNRRNLPGDRAKALDIMIPMVQSEEQVASDMYCLVGRIYKDMFLDSNFTDTESRD
HGASWFKKAFESEPTLQSGINYAVLLLAAGHQFESSFELRKVGVKLSSLLGKKGNLEKLQ
SYWEVGFFLGASVLANDHLRVIQASEKLFRLKTPAWYLKSIVETILIYKHFVKLTTEQPS
AKQELVDFWMDFLVEATKTDVTVVRFPVLILEPTKIYQPSYLSINNEVEEKTISIWHVLP
DDKKGIHEWNFGASSVRGVSISKFEERCCFLYVLHNSDDFQIYFCTELHCKRFFEMVNTI
TEEKGRGAEDGDCEGDSLEYDYEYDENGDRVVLGKGTYGIVYAGRDLSNQVRIAIKEIPE
RDSRYSQPLHEEIALHKHLKHKNIVQYLGSFSENGFIKIFMEQVPGGSLSALLRSKWGPL
KDNEQTIGFYTKQILEGLKYLHDNQIVHRDIKGDNVLINTYSGVLKISDFGTSKRLAGIN
PCTETFTGTLQYMAPEIIDKGPRGYGKAADIWSLGCTIIEMATGKPPFYELGEPQAAMFK
VGMFKVHPEIPESMSAEAKAFILKCFEPDPDKRACANDLLIDEFLKVSSKKKKTQPKLSA
LSTGSNEYLRSISLPVPVLVEDTSSSSEYGSVSPDTELKADPFSFKARAKSCGEKDGKGI
RTLFLGIPDENFEDHSAPPSPEEKDSGFFMLRKDSERRATLHRILTEDQDKVVRNLMESL
AQGAEEPKLKWEHITTLISSLREFVRSTDRKIIATTLSKLKLELDFDSHGISQVQVVLFG
FQDAVNKVLRNHNIKPHWMFALDSIIRKAVQTAITILVPELRPHFSLASESDTADPEDLD
VEDEHEELSSNQTVRRPQAITEDAVATSGVSTLSSTVSHDSQNAHRSLNVQLGRMKIETN
RLLEELVRKERELQALLHQAIEEKDQEIRHLKLKSQPIDIPGFPVCHLNSPGTTTEDSEL
PGWLRENGADEDTISRFLAEDYTLVDVLYYVTRDDLKCLRLRGGMLCTLWKAIIDFRNKC
NT seq 4143 nt NT seq  +upstreamnt  +downstreamnt
atgggcaccgaagccggcgagggcatcactttctccgtgccgccctttgcgtccgtgggc
ttttgcaccatcccggagggcggcagctgccggaggggaggaggagcggcgacggcggcg
gagggagagccgagcctgcagcccttgcttgtgccgccgccgccgccaccgccgggcagt
ttctggaacgtggagagcgcggcggctcccggcaccagctgccctaccaccgcccccggg
agcagcgccacccgaggccggggcaactctggcagcgggggcggccggcgtaccaccgtg
gcttatgtgatcaatgaggcgagccaggggcagctggtggtggcggagagcgaggccctg
cagagcctgcgggaggcgtgcgaggcggtgggcgccaccctggagaccctgcatttcggg
aagctggacttcggggaaaccgccgtgctggaccgtttttacaacgcagatattgctgtg
gtggagatgagcgacgccttccggcagccttccttgttttaccatcttggagtgcgagaa
agcttcagtatggccaacaacatcatcctctactgcgatactaattccgattcactccag
tccctgaaggaaattatttgccagaagaatactgtgtgcaccgggaactacaccttcatc
ccctacatggtgacaccacacaacaaggtctactgctgtgacagcagcttcatgaagggc
ctgactgagctcatgcagcctaacttcgagctcctgctggggcccatctgcttacccctc
gtggaccgtttcgttcagcttttgaaggtggcgcaagcgagttccagccagtacttccgg
gaatccatactcagcgatatcaggaaagcacggaacctgtacactggtaaagaattggca
gctgaattggcgaggatccggcaacgggtagacaatattgaagttttgacagcagacatt
gttatcaacctgttgctttcctacagagacatccaggactatgactccatagtgaagctg
gtagagacgttagaaaaacttccaaccttcgacttggcctcgcaccaccacgtgaagttt
cattacgcatttgcactgaacaggagaaatctccctggagacagagcaaaagctcttgac
atcatgatccccatggtacaaagtgaagagcaagttgcttcggatatgtattgtctcgtt
ggccgaatctacaaagatatgtttttggattcaaatttcactgacacggaaagcagggac
catggagcatcttggttcaaaaaggcatttgagtctgagccaacactacagtcaggaatt
aattatgcagttctcttgctggcggctgggcaccagtttgaatcttcttttgagcttcgg
aaagttggagtgaagctgagtagccttctgggtaaaaaggggaacttggaaaaactccag
agctactgggaagtcggattttttctgggagccagtgtcctggccaacgaccacctcagg
gtcattcaggcatccgagaagctgttcagactgaagacaccagcgtggtacctcaagtct
atcgtggagaccattctgatatataaacactttgtgaaactgaccacagagcagccctcg
gctaagcaggaactcgtggacttctggatggatttcctggtcgaggccacaaaaacagat
gttactgttgtcaggttcccagtattaatattagagccaaccaaaatctatcagccttct
tacctgtctatcaataatgaagttgaggagaagacaatatctatttggcatgttctccct
gatgacaagaaaggtatacacgagtggaacttcggtgcttcctctgtcaggggagtgagc
atctctaagtttgaagaacgatgctgtttcctttatgtgcttcacaattctgatgacttc
caaatctacttctgcacagaacttcactgtaaaaggttttttgaaatggtgaataccatc
acggaagagaaggggagaggcgcggaggacggagactgtgagggtgactccctggagtat
gactacgaatacgatgaaaatggagacagagttgtgttagggaagggcacttatgggatc
gtctatgcaggacgagacctgagcaaccaggtcagaattgctattaaggaaatcccagag
agagacagcagatactctcagcccctgcatgaagaaatcgccctgcacaagcatctgaaa
cacaaaaacattgtccagtatctgggctccttcagtgagaacggcttcatcaaaatcttc
atggagcaagtcccaggaggaagcctctctgctctccttcgttcaaaatggggcccatta
aaggacaacgaacagacgattggcttctatacgaagcagatactggaaggattaaaatac
cttcacgacaatcagatagtccaccgggatataaagggtgacaatgtattgattaatacc
tacagtggtgtgctcaagatctctgacttcgggacatccaagaggcttgctggcataaac
ccatgtaccgaaacctttacaggtacccttcagtatatggcgccagaaataatcgataaa
ggaccacgaggctatggaaaggccgccgacatttggtcactgggctgcacaatcatcgaa
atggctactggaaaaccaccattttatgaactaggagagccacaggcagccatgttcaag
gtggggatgtttaaggtccacccggagatcccagagtccatgtcggcggaggccaaggcg
ttcatactgaagtgttttgaaccagaccctgacaagagagcctgtgctaatgacttgctt
attgatgagttcttaaaagtgtccagcaaaaagaaaaagacacaacccaaactttcagct
ctctcgactggatcgaatgagtatcttagaagcatctccctgccggtccctgtcctggta
gaagacaccagcagcagtagcgagtatggctctgtttctcctgatacagagctgaaggcg
gaccccttctccttcaaagccagagctaagtcctgtggagaaaaggacgggaaagggata
cggacattgttcctgggcattccagatgaaaattttgaagatcacagtgcgcccccatct
cctgaagagaaagactcgggcttttttatgctgagaaaggatagtgagaggcgagctacc
cttcacagaatcctgaccgaagaccaggacaaggttgtaaggaacctaatggaatctctg
gcccagggtgctgaagagcctaaactaaagtgggaacacatcacaaccctcatctcgagc
ctcagagagtttgtgaggtccactgaccgaaaaatcatagccactacactgtccaagctc
aagctggagctggacttcgacagccacggcatcagccaggtgcaggtggtcctctttggc
ttccaggatgcggtcaataaagttcttcggaatcataacatcaagccacactggatgttt
gccctggacagcatcatccgaaaggctgtgcagactgcaattaccattctggttccagag
ttgaggccacattttagccttgcatcagagagcgacacagctgatccggaagacctggat
gtcgaagatgaacacgaggaattgtcttcaaatcagacagtccgacggcctcaggccatc
actgaggacgctgtggctacctcgggggtgagcacgctaagctccactgtgtcccatgac
tcccagaatgcacaccggtcgctgaacgtgcagcttggaaggatgaagattgaaactaat
aggttacttgaagagctggttcggaaagagagagagttacaggcactcctccatcaagcc
attgaggaaaaagaccaagaaattaggcacctgaagctcaagtcccagcccatagatatc
cctgggtttcctgtgtgccacctgaactctcctggcacgaccacggaagattctgaactt
cctggctggctgagagaaaatggagctgatgaagacactataagtcggtttctggctgag
gattacacgctagtggatgttctttactacgtcacacgtgatgatctgaagtgcctcaga
ctaaggggcgggatgctgtgcacgctgtggaaggccatcattgactttcggaacaaatgc
tga

DBGET integrated database retrieval system