KEGG   Mus musculus (mouse): 270084
Entry
270084            CDS       T01002                                 

Gene name
Lpcat2, 1-AGPAT_11, A330042H22, Aytl1, Aytl1a, lpafat1, lysoPAFAT, lysoPAFAT/LPCAT2
Definition
(RefSeq) lysophosphatidylcholine acyltransferase 2
  KO
K13510  lysophosphatidylcholine acyltransferase / lyso-PAF acetyltransferase [EC:2.3.1.23 2.3.1.67]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00564  Glycerophospholipid metabolism
mmu00565  Ether lipid metabolism
mmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    270084 (Lpcat2)
   00565 Ether lipid metabolism
    270084 (Lpcat2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mmu01004]
    270084 (Lpcat2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.23  1-acylglycerophosphocholine O-acyltransferase
     270084 (Lpcat2)
    2.3.1.67  1-alkylglycerophosphocholine O-acetyltransferase
     270084 (Lpcat2)
Lipid biosynthesis proteins [BR:mmu01004]
 Phospholipid acyltransferase
  LPAAT/LPLAT
   270084 (Lpcat2)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 Acyltransferase EF-hand_8 EF-hand_5 EF-hand_4 IF2_N SPARC_Ca_bdg
Other DBs
NCBI-GeneID: 270084
NCBI-ProteinID: NP_766602
MGI: 3606214
Ensembl: ENSMUSG00000033192
Vega: OTTMUSG00000024681
UniProt: Q8BYI6
LinkDB
Position
8; 8 C5
AA seq 544 aa
MNRCAEAAAVAATVPGSGVGDAGLRPPMVPRQASFFPPPVPNPFVQQTTISASRRLQMFL
LGIILLPVRALLVGIILLLAWPFAVISTACCPEKLTHPISNWRRKITRPALTFLARAMFF
SMGFTVTVKGKVASPLEAPIFVVAPHSTFFDGIACVVAGLPSLVSRNENAQTPLVGRLLR
ALQPVLVSRVDPDSRKNTINEIKKRATSGGEWPQILVFPEGTCTNRSCLITFKPGAFIPG
VPVQPVLLRYPNKLDTVTWTWQGYTFLQLCVLTFCQLFTKVEIEFMPVQAPSEEEKNDPV
LFASRIRNLMAEALEIPVTDHTYEDCRLMISAGQLTLPMEAGLVEFSKISRKLKLDWDGI
RKHLDEYASIASSSKGGRIGIEEFAEYLKLPVSDVLRQLFALFDRNNDGSIDFREYVIGL
AVLCNPANTEEIIQVAFKLFDVDEDGYITEEEFCTILQASLGVPDLNVSGLFREIAQRDS
VSYEEFKSFALKHPEYAKIFTTYLDLQTCHVFSLPEEVQTAPSVASNKVSPESQEEGTSD
KKVD
NT seq 1635 nt   +upstreamnt  +downstreamnt
atgaaccgatgcgccgaggcggccgctgtggcggctacggtcccgggttcgggcgtcggg
gacgccgggctgcggccacccatggtacctcgccaggcgtccttcttcccgccgccggtg
cccaaccccttcgtccagcagactacgatcagtgcctcccgaaggctgcagatgtttctt
cttggaattattctgctcccagtccgtgctttactggttggaataattttgctgctcgca
tggccatttgctgtcatttcaacagcatgctgtcctgaaaagctgacccatccaataagc
aattggaggaggaagatcactcggcccgctttgacatttctggcgcgtgccatgttcttc
tccatggggtttacggttaccgtgaaaggaaaggttgcaagccctctggaagcgcccatt
tttgtcgtcgctcctcattccacgttcttcgacggaattgcctgtgtagtagctgggctg
ccttcgctggtatcacggaatgagaatgcacagacccctctggttggcagactgttacgg
gctttgcagccagttttggtatcccgtgttgaccctgactcccgaaaaaacacaatcaat
gaaatcaaaaagcgagcgacatcaggtggagaatggccccagatactagttttcccagaa
ggtacttgtactaatcgctcctgtttgattacttttaaaccaggagccttcatcccagga
gttccagtgcagcccgtcctcctcagatacccaaacaagttggatactgtgacctggacc
tggcaaggctatacattcctccagctgtgtgtgctcactttctgtcaactcttcacgaag
gtggagattgagtttatgcctgtgcaagcacccagtgaggaagagaagaacgatcctgtc
cttttcgccagtagaatccggaacttaatggctgaagcattggaaatacccgtgacggat
cacacctacgaagactgcaggctgatgatctcagcgggacagctcacgttgcctatggag
gccgggctggtagaattttcaaagattagccggaaactgaaattagactgggatggtatc
cggaagcacttggatgaatatgcgtctatcgcaagctcttccaaaggaggcagaattgga
atcgaggagtttgcggaatacttgaagctacctgtttccgatgtcctgagacaacttttt
gcactctttgacaggaataatgatggcagtattgacttccgagagtatgtgatcggcctg
gctgtcttgtgcaaccctgccaatacagaagagatcatccaggtggcatttaagctcttt
gatgttgatgaggacggctacataacagaggaggagttttgcaccattctgcaggcttct
cttggagtgcctgaccttaatgtttctggtctcttcagagaaattgcccaacgggactct
gtttcctacgaggaattcaaaagtttcgccctaaagcacccagaatatgccaagatattt
accacatacctagacctccagacatgccatgtattctccttgccagaagaggtccagaca
gctccctctgttgctagtaataaagtcagtcctgagagccaggaggagggcacctcagac
aaaaaggtggactga

DBGET integrated database retrieval system