KEGG   Mus musculus (mouse): 27015
Entry
27015             CDS       T01002                                 

Gene name
Polk, DINP, Din, Dinb1
Definition
(RefSeq) polymerase (DNA directed), kappa
  KO
K03511  DNA polymerase kappa [EC:2.7.7.7]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03460  Fanconi anemia pathway
mmu05169  Epstein-Barr virus infection
mmu05200  Pathways in cancer
mmu05202  Transcriptional misregulation in cancer
mmu05210  Colorectal cancer
mmu05212  Pancreatic cancer
mmu05213  Endometrial cancer
mmu05214  Glioma
mmu05216  Thyroid cancer
mmu05217  Basal cell carcinoma
mmu05218  Melanoma
mmu05220  Chronic myeloid leukemia
mmu05222  Small cell lung cancer
mmu05223  Non-small cell lung cancer
mmu05224  Breast cancer
mmu05225  Hepatocellular carcinoma
mmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    27015 (Polk)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    27015 (Polk)
   05202 Transcriptional misregulation in cancer
    27015 (Polk)
  09162 Cancer: specific types
   05210 Colorectal cancer
    27015 (Polk)
   05212 Pancreatic cancer
    27015 (Polk)
   05225 Hepatocellular carcinoma
    27015 (Polk)
   05226 Gastric cancer
    27015 (Polk)
   05214 Glioma
    27015 (Polk)
   05216 Thyroid cancer
    27015 (Polk)
   05220 Chronic myeloid leukemia
    27015 (Polk)
   05217 Basal cell carcinoma
    27015 (Polk)
   05218 Melanoma
    27015 (Polk)
   05213 Endometrial cancer
    27015 (Polk)
   05224 Breast cancer
    27015 (Polk)
   05222 Small cell lung cancer
    27015 (Polk)
   05223 Non-small cell lung cancer
    27015 (Polk)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    27015 (Polk)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mmu03400]
    27015 (Polk)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     27015 (Polk)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  TLS (translesion DNA synthesis) factors
   Y-family DNA polymerases
    27015 (Polk)
SSDB
Motif
Pfam: IMS IMS_C IMS_HHH ATP-cone zf-C2H2_12
Other DBs
NCBI-GeneID: 27015
NCBI-ProteinID: NP_036178
MGI: 1349767
Ensembl: ENSMUSG00000021668
UniProt: Q9QUG2 Q9CRV6 Q3UUL1
LinkDB
Structure
PDB: 
2LSJ

Position
13; 13 D1
AA seq 852 aa
MDNTKEKDNFKDDLLLRMGLNDNKAGMEGLDKEKINKIIMEATKGSRFYGNELKKEKQVN
QRIENMMQQKAQITSQQLRKAQLQVDKFAMELERNRNLNNTIVHVDMDAFYAAVEMRDNP
ELKDKPIAVGSMSMLATSNYHARRFGVRAAMPGFIAKRLCPQLIIVPPNFDKYRAVSKEV
KEILAEYDPNFMAMSLDEAYLNITQHLQERQDWPEDKRRYFIKMGNYLKIDTPRQEANEL
TEYERSISPLLFEDSPPDLQPQGSPFQLNSEEQNNPQIAQNSVVFGTSAEEVVKEIRFRI
EQKTTLTASAGIAPNTMLAKVCSDKNKPNGQYQILPSRSAVMDFIKDLPIRKVSGIGKVT
EKMLMALGIVTCTELYQQRALLSLLFSETSWHYFLHIALGLGSTDLARDGERKSMSVERT
FSEISKTEEQYSLCQELCAELAHDLQKEGLKGRTVTIKLKNVNFEVKTRASTVPAAISTA
EEIFAIAKELLRTEVNVGSPHPLRLRLMGVRMSTFSSEDDRKHQQRSIIGFLQAGNQALS
STGDSLDKTDKTELAKPLEMSHKKSFFDKKRSERISNCQDTSRCKTAGQQALQILEPSQA
LKKLSESFETSENSNDCQTFICPVCFREQEGVSLEAFNEHVDECLDGPSTSENSKISCYS
HASSADIGQKEDVHPSIPLCEKRGHENGEITLVDGVDLTGTEDRSLKAARMDTLENNRSK
EECPDIPDKSCPISLENETISTLSRQDSVQPCTDEVVTGRALVCPVCNLEQETSDLTLFN
IHVDICLNKGIIQELRNSEGNSVKQPKESSRSTDRLQKASGRTKRPGTKTKSSTLKKTKP
RDPRHTLDGFFK
NT seq 2559 nt   +upstreamnt  +downstreamnt
atggataacacaaaggaaaaggacaacttcaaagacgacctcctgctccgcatgggacta
aacgataacaaagcaggcatggaagggttggataaggagaaaattaacaaaattatcatg
gaagccacaaaggggtccagattttatggaaatgagctcaagaaggaaaagcaagtcaat
caacggattgaaaatatgatgcaacaaaaagctcaaattaccagccagcaactaaggaaa
gctcaattacaggttgacaaatttgcaatggagttagaacggaaccggaatttgaacaat
accatagttcatgttgacatggacgctttctatgcagctgtggaaatgagggacaacccg
gaactgaaggataaacccattgctgtaggatccatgagcatgttggctacttcgaattac
catgcaaggaggtttggtgtccgtgcagccatgccaggatttattgctaagaggctctgc
ccacaacttattatagtgcccccaaactttgacaaatatagagctgtgagtaaggaggtt
aaggagatacttgctgaatatgatcccaattttatggccatgagtctggacgaagcctac
ttgaatataacacagcacttgcaggaaaggcaagattggcctgaggacaaaagaagatac
ttcatcaagatgggaaactacttaaaaatcgacacacccagacaggaagctaacgagctg
actgagtatgagcggtccatctccccgctgctttttgaagatagtcctcctgatttgcaa
ccccaaggaagtcctttccaactgaactctgaagaacaaaacaatcctcaaatagcccaa
aattcagttgtttttggaacatcagctgaggaagtggtaaaggaaattcgcttcagaatt
gaacaaaaaacaacgctgacagccagcgcaggcatcgcccccaatacaatgttagcaaaa
gtgtgcagtgataagaataagccaaacggacagtaccagatccttcccagcaggagcgcg
gtgatggacttcatcaaggacctgcctattagaaaggtttctgggataggaaaagttaca
gagaaaatgttaatggctctcgggattgttacttgcacagaactctaccaacagagagcg
ttgctgtctctccttttctctgaaacctcttggcattattttcttcacatcgcgctgggt
ctaggttcaacagacctggcaagggatggagaaaggaaaagcatgagtgttgaaaggaca
ttcagtgagataagtaagacagaggaacagtacagcctgtgccaagaactgtgcgctgag
ctcgcccacgacctccagaaggaaggacttaagggaagaaccgtcaccattaagctgaag
aacgtgaattttgaagtaaaaactcgtgcatctaccgttccggccgccatttctactgca
gaggaaatatttgccattgccaaggagctgctaaggacagaagttaatgtgggttctcca
caccccctgcggttaagactgatgggtgtccgaatgtctactttttccagtgaagatgac
aggaaacaccaacaaaggagcatcattggtttcttacaagctggaaaccaagctttgtca
tctactggggatagtctagacaaaactgacaaaactgagcttgcaaagcccttagaaatg
tctcataagaagagtttctttgataaaaagcgatcagaaagaatctccaactgtcaagac
acatccagatgtaaaactgcgggtcagcaagctttacagatcttggaaccatcccaagca
ttaaagaagctgagcgagagttttgaaacatcagagaattcaaatgactgtcagacattt
atatgtccagtttgctttagggagcaagaaggtgtcagtctggaagcctttaatgaacat
gtagatgagtgtcttgatggaccgtcaaccagtgagaactcaaaaatatcctgttactca
catgcttcctctgcagacattggtcagaaggaagatgtacacccctctattccactgtgt
gagaaacgggggcatgaaaatggagagatcactttagtagatggtgtagatctaacaggg
acggaagacagatcattgaaagcagcaaggatggacactctagagaataatcgcagcaaa
gaggaatgtcctgatattccagacaagtcttgtcctatatcactggaaaatgaaaccatc
agtacattaagtaggcaagactctgtccagccttgtacagatgaggtagtaacaggacga
gctctagtgtgtcctgtttgtaacctagaacaagagacttctgatcttaccctcttcaac
atacatgtggatatttgcttaaataaaggtattatccaagaactgagaaatagtgaaggt
aattcagttaaacaacccaaagaaagctcgagaagtactgacagacttcagaaggcttca
ggaaggaccaaaaggccaggaacgaagacaaagagctcaactttgaagaaaacaaagccc
cgagatcccagacacacccttgatggattttttaaatga

DBGET integrated database retrieval system