KEGG   Mus musculus (mouse): 27379Help
Entry
27379             CDS       T01002                                 

Gene name
Tcl1b1, C88214
Definition
(RefSeq) T cell leukemia/lymphoma 1B, 1
  KO
K16836  T-cell leukemia/lymphoma 1B
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    27379 (Tcl1b1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TCL1_MTCP1
Motif
Other DBs
NCBI-GeneID: 27379
NCBI-ProteinID: NP_038801
MGI: 1351601
Ensembl: ENSMUSG00000066359
UniProt: P56840 Q3UWQ4
LinkDB All DBs
Position
12; 12 E
AA seq 116 aa AA seqDB search
MAAAAFDPLGPLPVYLVSVRLGIYEDEHHRVWIVANVETSHSSHGNRRRTHVTVHLWKLI
PQQVIPFNPLNYDFLPTTWKLESRNIYWATDGTHWRLLDHSQLGDTEQLILMLVLG
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
atggctgctgcagcttttgatcccctggggccacttccagtctacctggtctccgttaga
ctgggcatctatgaggatgaacatcatagagtgtggatagttgcaaatgtggaaacttct
cactcatcacatggcaacaggaggagaacccatgtaactgtccacttgtggaagttaatc
ccccagcaggttattcccttcaaccccttgaattacgactttctacccacgacgtggaaa
ttagagtccaggaacatatactgggcaacagatgggactcactggagattactggatcat
tcccagttgggtgacacagagcaactgatcctgatgctggtgttagggtga

DBGET integrated database retrieval system