KEGG   Mus musculus (mouse): 27401Help
Entry
27401             CDS       T01002                                 

Gene name
Skp2, 4930500A04Rik, FBXL1, FWD1, p45
Definition
(RefSeq) S-phase kinase-associated protein 2 (p45)
  KO
K03875  F-box and leucine-rich repeat protein 1 (S-phase kinase-associated protein 2)
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04068  FoxO signaling pathway
mmu04110  Cell cycle
mmu04120  Ubiquitin mediated proteolysis
mmu04150  mTOR signaling pathway
mmu05169  Epstein-Barr virus infection
mmu05200  Pathways in cancer
mmu05203  Viral carcinogenesis
mmu05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    27401 (Skp2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    27401 (Skp2)
   04150 mTOR signaling pathway
    27401 (Skp2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    27401 (Skp2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    27401 (Skp2)
   05203 Viral carcinogenesis
    27401 (Skp2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    27401 (Skp2)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    27401 (Skp2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    27401 (Skp2)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     27401 (Skp2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: F-box-like F-box F-box_5
Motif
Other DBs
NCBI-GeneID: 27401
NCBI-ProteinID: NP_038815
MGI: 1351663
Ensembl: ENSMUSG00000054115
Vega: OTTMUSG00000045656
UniProt: Q9Z0Z3 Q569Z9
LinkDB All DBs
Position
15; 15 A1
AA seq 424 aa AA seqDB search
MHRKHLQEIPDQSGNVTTSFTWGWDSSKTSELLSGMGVSALEKEEVDSENIPHGLLSNLG
HPQSPPRKRVKGKGSDKDFVIIRRPKLSRENFPGVSWDSLPDELLLGIFSCLCLPELLRV
SGVCKRWYRLSLDESLWQSLDLAGKNLHPDVTVRLLSRGVVAFRCPRSFMEQPLGESFSS
FRVQHMDLSNSVINVSNLHKILSECSKLQNLSLEGLQLSDPIVKTLAQNENLVRLNLCGC
SGFSESAVATLLSSCSRLDELNLSWCFDFTEKHVQAAVAHLPNTITQLNLSGYRKNLQKT
DLCTIIKRCPNLIRLDLSDSIMLKNDCFPEFFQLNYLQHLSLSRCYDIIPDTLLELGEIP
TLKTLQVFGIVPEGTLQLLREALPRLQINCAYFTTIARPTMDSKKNLEIWGIKCRLTLQK
PSCL
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgcataggaagcaccttcaggagattccggaccagagtggcaacgtcaccaccagcttc
acgtggggatgggattccagcaagacttctgaactgctatcaggcatgggtgtctcggcc
ttggagaaggaggaggtggacagtgagaacatcccacatggactgctctcaaacctcggc
cacccccagagccctccaaggaaacgagtcaagggcaaagggagtgacaaagactttgtg
atcatccgtcggccgaagcttagtcgggagaactttccaggtgtctcctgggactccctt
ccagatgagctgctccttgggatcttttcctgtctgtgcctccctgagctgctgagagtc
tcgggcgtttgcaagaggtggtaccgcctctcgctcgatgagtctctctggcagtccctc
gacctcgcgggtaaaaatctgcacccagacgtgactgtgcgcttgctctcccgcggggtg
gtcgccttccgctgccctcggtcctttatggagcagccgctgggtgaaagcttcagctct
ttccgggtacagcacatggacctgtcgaactcagtgataaatgtgtcgaacctccataag
attctgtccgagtgctccaagctgcagaatctaagcctggaaggcctgcagctctcagac
cccattgtcaagactcttgcacagaatgaaaacttggtgcgactaaacctttgtgggtgc
tctgggttttctgaatctgccgtggcgactctgctaagcagctgctccagactggatgag
ctaaatctctcctggtgctttgacttcactgaaaagcacgtgcaagcggctgtggcacat
ttaccaaacaccatcacccagctgaacctcagcggctaccgaaagaacctccagaaaaca
gatctttgtaccataattaaacgatgccccaacctcatccgcctcgacttaagtgacagt
atcatgctaaagaatgactgctttccagaattttttcaactcaactacctccaacacctc
tcgctcagccggtgctatgatataatacctgatactctacttgaacttggagaaattcct
acactaaaaacgctacaagtttttggaatcgtgccagagggaacccttcagctactgagg
gaagctcttcctcggctgcagattaactgcgcctatttcaccaccattgcaaggccaact
atggacagcaagaagaacctggagatttggggtatcaagtgccgactgactctgcaaaag
cccagttgtctatga

DBGET integrated database retrieval system