KEGG   Mus musculus (mouse): 319583Help
Entry
319583            CDS       T01002                                 

Gene name
Lig4, 5830471N16Rik, tiny
Definition
(RefSeq) ligase IV, DNA, ATP-dependent
  KO
K10777  DNA ligase 4 [EC:6.5.1.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    319583 (Lig4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mmu03400]
    319583 (Lig4)
Enzymes [BR:mmu01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     319583 (Lig4)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA Ligase 4 complex
     319583 (Lig4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C BRCT DNA_ligase_IV BRCT_2 RNA_ligase mRNA_cap_enzyme LIG3_BRCT APG17
Motif
Other DBs
NCBI-GeneID: 319583
NCBI-ProteinID: NP_795927
MGI: 1335098
Ensembl: ENSMUSG00000049717
Vega: OTTMUSG00000059042
UniProt: Q8BTF7
LinkDB All DBs
Position
8; 8 A1.1
AA seq 911 aa AA seqDB search
MASSQTSQTVAAHVPFADLCSTLERIQKGKDRAEKIRHFKEFLDSWRKFHDALHKNRKDV
TDSFYPAMRLILPQLERERMAYGIKETMLAKLYIELLNLPREGKDAQKLLNYRTPSGART
DAGDFAMIAYFVLKPRCLQKGSLTIQQVNELLDLVASNNSGKKKDLVKKSLLQLITQSSA
LEQKWLIRMIIKDLKLGISQQTIFSIFHNDAVELHNVTTDLEKVCRQLHDPSVGLSDISI
TLFSAFKPMLAAVADVERVEKDMKQQSFYIETKLDGERMQMHKDGALYRYFSRNGYNYTD
QFGESPQEGSLTPFIHNAFGTDVQACILDGEMMAYNPTTQTFMQKGVKFDIKRMVEDSGL
QTCYSVFDVLMVNKKKLGRETLRKRYEILSSTFTPIQGRIEIVQKTQAHTKKEVVDALND
AIDKREEGIMVKHPLSIYKPDKRGEGWLKIKPEYVSGLMDELDVLIVGGYWGKGSRGGMM
SHFLCAVAETPPPGDRPSVFHTLCRVGSGYTMKELYDLGLKLAKYWKPFHKKSPPSSILC
GTEKPEVYIEPQNSVIVQIKAAEIVPSDMYKTGSTLRFPRIEKIRDDKEWHECMTLGDLE
QLRGKASGKLATKHLHVGDDDEPREKRRKPISKTKKAIRIIEHLKAPNLSNVNKVSNVFE
DVEFCVMSGLDGYPKADLENRIAEFGGYIVQNPGPDTYCVIAGSENVRVKNIISSDKNDV
VKPEWLLECFKTKTCVPWQPRFMIHMCPSTKQHFAREYDCYGDSYFVDTDLDQLKEVFLG
IKPSEQQTPEEMAPVIADLECRYSWDHSPLSMFRHYTIYLDLYAVINDLSSRIEATRLGI
TALELRFHGAKVVSCLSEGVSHVIIGEDQRRVTDFKIFRRMLKKKFKILQESWVSDSVDK
GELQEENQYLL
NT seq 2736 nt NT seq  +upstreamnt  +downstreamnt
atggcttcctcacaaacttcacaaactgttgcagctcatgtcccctttgcagacttatgt
tccacactagaacggatacagaaaggtaaagaccgtgcagaaaaaatcaggcacttcaag
gagtttttggattcgtggagaaaatttcatgatgcccttcataagaacagaaaggacgtt
acagactctttttaccctgcaatgagactcattctcccccagttagaaagagagaggatg
gcttatggaatcaaagaaaccatgctcgctaagctctacatcgaattgctgaacttacca
cgagaaggcaaggatgcccagaagctcctcaattaccgaacccccagtggagctcgcacg
gatgctggggactttgccatgattgcatactttgttttgaagccaaggtgcttacagaaa
ggaagcttaaccatacagcaggtaaatgaactcttagacttagttgccagcaataactct
ggcaaaaaaaaagacctagtgaaaaagagccttcttcagttaataacccagagttcagca
ctggagcaaaaatggctgattcgcatgattatcaaagacttaaagcttggcatcagtcag
caaacaatattttccattttccacaatgatgcagttgagttgcacaacgtcaccacagat
ctggaaaaggtctgcaggcagctgcatgacccctctgtagggcttagtgacatctctatc
actctgttttctgcctttaagccaatgctagctgctgtagcagacgtggagcgtgtggag
aaggacatgaagcagcagagtttctacatcgaaactaagcttgatggtgagcgcatgcag
atgcacaaagatggcgcgctgtaccggtacttctccagaaacggttacaactataccgac
cagtttggtgaatctccacaggaaggctctctcaccccatttattcacaatgcgttcggg
acagatgtgcaagcgtgcatccttgacggtgagatgatggcctacaacccaacaacacag
actttcatgcagaagggggtcaagtttgatatcaaaaggatggtggaagattctggccta
cagacttgttactctgtttttgacgtactgatggttaataagaagaagctagggcgcgag
actcttaggaagaggtatgagatccttagtagcactttcacacccatacaaggccgcata
gaaatagtgcagaaaactcaagctcatacaaagaaggaagtagtggatgcattaaatgat
gccatagacaagagagaagaggggatcatggttaaacaccctctgtccatttacaagcca
gacaaaagaggtgaagggtggctaaagattaaaccagagtacgtcagtggactaatggat
gaattagacgtcctaattgtggggggctactggggtaaaggttcacgaggtggcatgatg
tctcactttttgtgtgcagtggcagagacaccacctcctggtgacaggccatctgtattc
cacactctgtgccgtgttgggtctggttacaccatgaaagaactctatgacctgggcttg
aaattggcaaaatactggaagccttttcataagaaatctccaccaagtagcattctgtgt
ggtacagagaagccggaagtgtacatagagcctcagaactctgtcattgttcagatcaag
gcagctgagatcgtccccagtgacatgtacaagactggctccaccctgcgcttcccacgc
atcgaaaagatcagagatgacaaagagtggcacgaatgtatgacactgggtgacttggag
cagctgagggggaaagcatctgggaagcttgccacgaaacaccttcatgtaggtgatgat
gatgaacctagagaaaaaaggcggaagcccatctccaagacgaagaaagccattagaatc
attgaacacttaaaagcacccaacctttctaacgtaaacaaagtttccaatgtatttgaa
gatgttgagttttgtgttatgagtggattagatggttatccaaaggctgacctagagaac
agaattgcagaattcggtggttatatagtacagaatccaggcccggatacatactgtgtt
attgcaggttctgagaacgttagagtgaaaaacattatttcttcagataaaaatgatgtt
gtcaagcccgagtggcttttagagtgttttaagacaaaaacatgcgtgccgtggcaacct
cgctttatgattcacatgtgcccgtcgacaaagcagcattttgcccgtgagtatgactgc
tatggtgatagctattttgttgacacagatttggatcaattgaaagaagtgtttctagga
attaaacccagtgagcagcagactcctgaagaaatggcccctgtgattgctgacttagaa
tgtcgttattcctgggaccactctcctctcagtatgtttcgacattacaccatttatttg
gacttgtatgctgttattaatgacttgagttccagaattgaagccacgagattaggtatt
acagcccttgagctgcggtttcatggagcaaaggtggtttcctgcttatctgaaggggta
tctcatgttatcattggggaggatcagagacgagttactgactttaaaatattcagaaga
atgcttaagaaaaagtttaaaatcctgcaagaaagttgggtgtccgattcagtagacaag
ggcgaactgcaggaggaaaaccagtatttgctttag

DBGET integrated database retrieval system