KEGG   Mus musculus (mouse): 320202Help
Entry
320202            CDS       T01002                                 

Gene name
Lefty2, 6030463A22Rik, Ebaf, Lefta, Leftb, lefty-2, lefty-B
Definition
(RefSeq) left-right determination factor 2
  KO
K04668  left-right determination factor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04350  TGF-beta signaling pathway
mmu04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    320202 (Lefty2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    320202 (Lefty2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    320202 (Lefty2)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   320202 (Lefty2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TGFb_propeptide TGF_beta
Motif
Other DBs
NCBI-GeneID: 320202
NCBI-ProteinID: NP_796073
MGI: 2443573
Ensembl: ENSMUSG00000066652
Vega: OTTMUSG00000021474
UniProt: P57785
LinkDB All DBs
Position
1; 1 H4
AA seq 368 aa AA seqDB search
MKSLWLCWALWVLPLAGPGAAMTEEQVLSSLLQQLQLSQAPTLDSADVEEMAIPTHVRSQ
YVALLQGSHADRSRGKRFSQNFREVAGRFLMSETSTHLLVFGMEQRLPPNSELVQAVLRL
FQEPVPRTALRRFERLSPHSARARVTIEWLRVREDGSNRTALIDSRLVSIHESGWKAFDV
TEAVNFWQQLSRPRQPLLLQVSVQREHLGPGTWSAHKLVRFAAQGTPDGKGQGEPQLELH
TLDLKDYGAQGNCDPEVPVTEGTRCCRQEMYLDLQGMKWAENWILEPPGFLTYECVGSCL
QLPESLTIGWPFLGPRQCVASEMTSLPMIVSVKEGGRTRPQVVSLPNMRVQTCSCASDGA
LIPRGIDL
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgaagtccctgtggctttgctgggcactctgggtactgcccctggctggccctggggca
gcgatgaccgaggaacaggtcctgagcagtctactgcagcagctgcagctcagccaggcc
cccaccctggacagcgcggatgtggaggagatggccatccctacccacgtgaggtcccag
tatgtggccctgctgcagggaagtcacgctgaccgctcccgaggcaagaggttcagccag
aattttcgagaggtggcaggcaggttcctgatgtcagagacctccactcacctgctagtg
ttcggaatggagcagcggctgccgcctaacagcgagctggtgcaggctgtgctgcggctg
ttccaggagcctgtgcccagaacagctctccggaggtttgagaggctgtccccacacagt
gcccgggctcgggtcaccattgaatggctgagagtccgtgaggatggctccaatcgcact
gccctcatcgactctaggctcgtgtccatccacgagagcggctggaaggccttcgacgtg
accgaggccgtgaacttctggcagcagctgagccggccgaggcagccgctgctgctccag
gtgtcggtgcagagggagcatctggggccggggacctggagcgcacacaagttggtccgt
ttcgcggcgcaggggacgccggacggcaaggggcagggcgagccacagctggagctgcac
acgctggacctcaaggactacggagctcaaggcaattgtgaccccgaggtaccagtgact
gaaggcacccgatgctgtcgccaggagatgtacctggacctgcaggggatgaagtgggcc
gagaactggatcctagaaccgccagggttcctgacgtatgaatgtgtgggcagctgcctg
cagctaccagagtccctgaccatcgggtggccatttctggggcctcggcagtgtgttgcc
tcagagatgacctccttgcccatgattgtcagtgtgaaggagggaggcaggaccaggcct
caagtggtcagcctgcccaacatgagggtgcagacctgtagctgcgcctcagatggggcg
ctcatacccagggggatagatctgtag

DBGET integrated database retrieval system