KEGG   Mus musculus (mouse): 328699Help
Entry
328699            CDS       T01002                                 

Gene name
Gabrr3
Definition
(RefSeq) gamma-aminobutyric acid (GABA) receptor, rho 3
  KO
K05190  gamma-aminobutyric acid receptor subunit rho
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04723  Retrograde endocannabinoid signaling
mmu04727  GABAergic synapse
mmu05032  Morphine addiction
mmu05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    328699 (Gabrr3)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    328699 (Gabrr3)
   04723 Retrograde endocannabinoid signaling
    328699 (Gabrr3)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    328699 (Gabrr3)
   05033 Nicotine addiction
    328699 (Gabrr3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    328699 (Gabrr3)
Ion channels [BR:mmu04040]
 Ligand-gated channels
  GABA-A
   328699 (Gabrr3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Motif
Other DBs
NCBI-GeneID: 328699
NCBI-ProteinID: NP_001074659
MGI: 3588203
Ensembl: ENSMUSG00000074991
UniProt: B2RXA8
LinkDB All DBs
Position
16; 16 C1.3
AA seq 464 aa AA seqDB search
MVLAVWLVSFTYTWITLMLDASAIKKPHQQCLSSPKQTRIRETRMRKDDLTKVWHPKREQ
LLHIEDHDFSTRPGFGGSPVPVGIDVQVESIDSISEVNMDFTMTFYLRHYWKDERLSFPS
TTNKSMTFDRRLLQKIWVPDIFFVHSKRSFIHDTTVENIMLRVHPDGNVLFSLRITVSAM
CFMDFSRFPLDTQNCSLELESYAYNEEDLMLYWKHGNKSLNTEERISLSQFFIEEFSASS
GLAFYSSTGWYYRLFINFVLRRHVFFFVLQTYFPAMLMVMLSWVSFWIDRRAVPARVSLG
ITTVLTMSTVVTGVSASMPQVSYVKAVDVYMWVSSLFVFLSVIEYATVNYLTTVEEWKQL
NRRGKISGMYHIDAVQAMAFDGCYHDSETDVDQTSFSLHSEEDSMSTKFTGSPCADSSQI
KRKSLGGNVGRIILENNHVIDTYSRIVFPTVYIIFNLFYWGIYV
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atggtcctggctgtttggttggtctccttcacctacacctggatcacactgatgctggat
gcctctgccatcaagaaaccccatcagcaatgtctctcttcaccgaaacaaacccgcatc
cgggaaactaggatgaggaaagacgaccttactaaagtctggcaccctaaacgtgaacaa
ctgttgcacattgaggaccacgatttctccacgaggcctgggtttggaggctcaccagtg
cccgtgggtatagatgtccaggttgaaagcatcgacagcatttcagaggtcaacatggac
tttaccatgacgttttacctcaggcactattggaaggatgagaggctctcctttcctagc
acgacaaacaaaagcatgaccttcgatcgcagactgctccaaaagatctgggtgcctgat
atcttctttgtccattctaaaagatccttcatccacgacacaaccgtggagaatatcatg
cttcgagtacatcccgatgggaatgttctattcagtctcaggataacagtttcggccatg
tgcttcatggacttcagccgctttcctctggacactcagaactgttctctagagctggaa
agctatgcctataatgaagaggacctaatgctctactggaaacacggcaacaagtcctta
aacacggaagagcgcatttccctttctcagttcttcattgaggagttcagcgcatccagt
ggactggctttctacagcagcacagggtggtactatagactgttcatcaactttgtgcta
cggaggcacgttttcttctttgtcctgcagacctattttccagccatgttgatggtgatg
ctttcctgggtctctttctggattgaccggagagctgttcctgcaagagtttccctgggg
atcacgacggtgctcaccatgtccacagtcgtcaccggtgtgagtgcctccatgccccag
gtgtcctatgtcaaggcggtggatgtgtacatgtgggtcagctccctctttgtgtttctg
tccgtcattgagtatgcaactgtgaattacctcaccacagtggaggagtggaaacaactc
aacaggaggggaaagatatctggaatgtaccatattgatgctgttcaagccatggccttc
gatggttgctaccatgacagcgagactgatgtggaccagacttccttctctctacactca
gaagaggactccatgagtacaaagttcacaggaagcccctgtgcagattcatctcagata
aaaaggaaatccctgggaggaaacgttggtagaatcatcctggaaaacaaccacgtcatc
gatacctattctagaattgtattccccaccgtttatataatatttaatttgttttactgg
ggtatatatgtgtga

DBGET integrated database retrieval system