KEGG   Mus musculus (mouse): 383619
Entry
383619            CDS       T01002                                 

Gene name
Aim2, Gm1313, Ifi2, Ifi210
Definition
(RefSeq) absent in melanoma 2
  KO
K12966  absent in melanoma 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04621  NOD-like receptor signaling pathway
mmu04623  Cytosolic DNA-sensing pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    383619 (Aim2)
   04623 Cytosolic DNA-sensing pathway
    383619 (Aim2)
SSDB
Motif
Pfam: HIN PYRIN AAA_lid_4 ProQ_C
Other DBs
NCBI-GeneID: 383619
NCBI-ProteinID: NP_001013801
MGI: 2686159
Ensembl: ENSMUSG00000037860
Vega: OTTMUSG00000033253
UniProt: Q91VJ1
LinkDB
Structure
PDB: 
4JBM 2N00

Position
1; 1 H3
AA seq 354 aa
MESEYREMLLLTGLDHITEEELKRFKYFALTEFQIARSTLDVADRTELADHLIQSAGAAS
AVTKAINIFQKLNYMHIANALEEKKKEAERKLMTNTKKRGTQKVENRSQAENCSAASATR
SDNDFKEQAATEVCPQAKPQKKQMVAEQEAIREDLQKDPLVVTVLKAINPFECETQEGRQ
EIFHATVATETDFFFVKVLNAQFKDKFIPKRTIKISNYLWHSNFMEVTSSSVVVDVESNH
EVPNNVVKRARETPRISKLKIQPCGTIVNGLFKVQKITEEKDRVLYGIHDKTGTMEVLVL
GNPSKTKCEEGDKIRLTFFEVSKNGVKIQLKSGPCSFFKVIKAAKPKTDMKSVE
NT seq 1065 nt   +upstreamnt  +downstreamnt
atggagagtgagtaccgggaaatgctgttgttgaccggcctggaccacatcacggaggaa
gaactgaaacggttcaagtactttgctttgactgagtttcagattgccaggagcacactc
gacgtggcagataggacagagttagctgaccacctgattcaaagtgcaggtgcggcgtct
gcagtgaccaaggccattaatattttccagaagttgaattatatgcatattgcaaatgct
cttgaagagaaaaagaaagaagctgaacgtaaactcatgaccaatacaaagaagagagga
acacagaaggtagaaaatagaagtcaagctgaaaactgctctgctgcctctgccacccgc
agtgacaatgactttaaggaacaggctgctacagaagtctgtcctcaagctaagcctcag
aagaaacagatggtggcagaacaggaagccatcagagaagatttacagaaagatccactt
gttgtcacggtgctgaaagctataaatccctttgagtgtgagactcaggaaggaagacaa
gagatatttcatgcaacagtggccacggagacagattttttctttgtaaaagttttaaac
gcacagtttaaagataaatttatcccaaagaggacaattaaaatatcaaactacctttgg
cacagtaacttcatggaggtcaccagttcctcagttgtggttgatgttgaatctaaccac
gaagtcccaaataacgttgttaagagagccagggaaactcccaggattagtaaactgaag
attcagccatgtggaacaattgtgaatgggctgtttaaagtccagaagataacagaggaa
aaagatagagtactgtatggtatacatgataaaacagggacaatggaggtgttggtgctg
ggaaacccaagcaaaacaaagtgcgaggaaggagacaagattagactcacgttctttgag
gtgtcaaaaaatggagtgaaaattcagttgaaatctggaccttgtagcttttttaaggtt
attaaggctgcaaagccaaaaactgacatgaaaagtgtggagtga

DBGET integrated database retrieval system