KEGG   Mus musculus (mouse): 436522Help
Entry
436522            CDS       T01002                                 

Gene name
Try10
Definition
(RefSeq) trypsin 10
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04972  Pancreatic secretion
mmu04974  Protein digestion and absorption
mmu05164  Influenza A
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    436522 (Try10)
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    436522 (Try10)
   04974 Protein digestion and absorption
    436522 (Try10)
 09160 Human Diseases
  09167 Infectious diseases
   05164 Influenza A
    436522 (Try10)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:mmu01002]
    436522 (Try10)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    436522 (Try10)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     436522 (Try10)
Peptidases [BR:mmu01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   436522 (Try10)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   436522 (Try10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin DUF1986 Trypsin_2
Motif
Other DBs
NCBI-GeneID: 436522
NCBI-ProteinID: NP_001034085
MGI: 3687012
Ensembl: ENSMUSG00000071521
Vega: OTTMUSG00000051419
UniProt: Q792Z1
LinkDB All DBs
Position
6; 6 B1
AA seq 246 aa AA seqDB search
MSTLLFLALVGAAVAFPVDDDDKIVGGYTCRENSVPYQVSLNSGYHFCGGSLINDQWVVS
AAHCYKSRIQVRLGEHNINVLEGNEQFIDAANIIKHPKFKKKTLDNDIMLIKLSSPVTLN
ARVATVALPSSCAAAGTQCLISGWGNTLSSGVNNPDLLQCLDAPLLPQADCEASYPGKIT
KNMICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCAQKDNPGVYTKVCNYVDWIQ
NTIAAN
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgagtacactcctgttcctggcccttgtgggagcagctgttgctttccctgtggatgat
gatgacaagatagttggaggatacacctgccgagagaattctgttccctaccaggtgtcc
ctgaactctggctaccacttctgtggaggttccctcatcaatgaccagtgggtggtgtct
gcagctcactgctacaagtcccgcatccaagtgagactgggagagcacaacatcaacgtc
ctggagggcaatgagcagtttatcgatgctgccaacatcatcaagcatcctaaattcaaa
aagaagactctggacaatgacatcatgctgatcaagctgtcttctcctgtgaccctcaat
gccagagtggccactgtggctctgcccagctcctgtgcagctgctggcactcagtgcctc
atctctggctggggcaacaccttgagctctggcgtgaacaacccagacctgctccagtgc
ctggatgctccactgctgcctcaggctgactgtgaggcctcctatcctggaaagatcacc
aagaacatgatctgtgttggcttcctggagggaggcaaagattcctgccagggtgactct
ggtggccctgtggtctgcaatggacagctccagggcattgtttcttggggctatggctgt
gcccagaaggacaaccctggtgtgtacaccaaggtctgcaactatgtggactggattcaa
aacaccattgctgcaaactaa

DBGET integrated database retrieval system