KEGG   Mus musculus (mouse): 436523Help
Entry
436523            CDS       T01002                                 

Gene name
Gm5771, EG436523
Definition
(RefSeq) predicted gene 5771
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Motif
Other DBs
NCBI-GeneID: 436523
NCBI-ProteinID: NP_001034086
MGI: 3646222
Ensembl: ENSMUSG00000058119
Vega: OTTMUSG00000051421
UniProt: Q792Y9
LinkDB All DBs
Position
6; 6 B1
AA seq 245 aa AA seqDB search
MSALLFLALVGAAVAFPVDDDKIVGGYTCRENSVPYQVSLNSGYHFCGGSLINDQWVVSA
AHCYKTRIQVRLGEHNIKVLEGNEQFVNAAKIIKHPNFNRKTLNNDIMLIKLSSPVTLNA
RVATVALPSSCAPAGTQCLISGWGNTLSFGVSEPDLLQCLDAPLLPQADCEASYPGKITG
NMVCAGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCALADNPGVYTKVCNYVDWIQD
TIAAN
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcactcctcttcctggcccttgtgggagctgctgttgctttccctgtggatgat
gataagatcgttggaggatacacctgccgagagaattctgttccctaccaggtgtccctg
aactctggctaccacttctgtggaggttccctcatcaatgaccagtgggtggtgtctgca
gctcattgctacaaaacccgcatccaagtgagattgggggagcacaacatcaaagtcctg
gagggcaatgagcagtttgtcaatgctgccaagatcatcaagcaccccaacttcaatagg
aagaccctcaataacgacatcatgttgatcaagctctcttcccctgtgaccctcaatgcc
agagtggccactgtggctctgcccagctcctgtgcgccagctggcactcagtgtctcatc
tctggctggggcaacactcttagctttggtgtcagtgaaccagacctgctccagtgcctg
gatgccccactgctgcctcaggctgactgtgaagcctcctatcctgggaagatcactggt
aacatggtctgtgctggcttcctagagggaggcaaggattcctgccagggtgactctggt
ggccctgtggtctgcaatggagagctccagggcattgtctcttggggctatggctgtgcc
ctggcagacaatcctggtgtgtacaccaaggtctgcaactatgtggattggattcaggac
acaattgctgccaactag

DBGET integrated database retrieval system