KEGG   Mus musculus (mouse): 446099
Entry
446099            CDS       T01002                                 

Gene name
Nlrp4e, 4930406H16Rik, Na, Nalp-epsilon, Nalp4e, Nlrp4
Definition
(RefSeq) NLR family, pyrin domain containing 4E
  KO
K22265  NACHT, LRR and PYD domains-containing protein 4
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    446099 (Nlrp4e)
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:mmu04054]
    446099 (Nlrp4e)
Membrane trafficking [BR:mmu04131]
 Autophagy
  Other autophagy associated proteins
   Others
    446099 (Nlrp4e)
Pattern recognition receptors [BR:mmu04054]
 Cytoplasmic pattern recognition receptors
  NOD-like receptors
   446099 (Nlrp4e)
SSDB
Motif
Pfam: NACHT PYRIN NLRC4_HD2 NOD2_WH LRR_6 AAA_16 AAA_30
Other DBs
NCBI-GeneID: 446099
NCBI-ProteinID: NP_001004194
MGI: 3056600
Ensembl: ENSMUSG00000045693
Vega: OTTMUSG00000027236
UniProt: Q66X19
LinkDB
Position
7; 7 A3
AA seq 978 aa
MASFFSDFGLMWYLEELNKKEFMKFKELLQQEILQLGLKHISWTEVKKASREDLANLLLK
HYEEKKAWDMTFKIFQKMNRQDLMERAGREIAGHSKLYQVHLKKKLTHDYARKFNIKDQD
SLKQKFTQDDCDHFENLLISKATGKKPHMVFLQGVAGIGKSLMLTKLMLAWSEGMVFQNK
FSYIFYFCCQDVKKMKRASLAELISKEWPNASAPIEEILSQPEKLLFVIDNLEVMECDMS
EWESELCDDCMEKQPVNILMSSLLRRKMLPESSFLVSATPETFEKIEDRIECTNVKMMAG
FNESSIKVYFYSLFQDRNRTQEIFSLVRENEQLFSVCQVPVLCWMVATCLKKEIEKGRDP
VSICRRITSLYTTYIFNLFIPHSAQYPSKKSQDQLQGLCSLAAEGMWTDTFVFAEEALRR
NGIMDSDISTLLDVRILEKSKESEKSYIFLHPSIQEVCAAIFHLLKSHVDHPSQDVKSIE
ALIFTFLKKVKIQWIFFGSFIFGLLHESEQKKLEAFFGHQLSQEIKRQLYQCLETISGNK
ELQEQIDGMKLFYCLFEMDDEAFLPQVMNCMEQIKFVAKDYSDVIVAAHCLQHCSTLKKL
SLSTQNILSEGQEHSYTEKLLICWHHVCSVLTSSKDIHVLQVKDTNFNERAFLVLYSHLK
YPSCILKVLEVNNVTLLCDNRLLFELIQNQRLQLLNLSLTFLSHNDVKLLCDVLNQAECN
IEKLMVADCNLSPDDCKVFVSVLISSKMLKHLNLSSNNLDKGISSLSKALCHPDCVLKNL
VLAKCSLSEECWHYLSEVLRRNKTLTHLDISFNDLKDEGLKVLCGALTLPDSVLISLSVR
YCLITTSGCQDLAEVLRNNQNLRNLQISNNKIEDAGVKLLCDAIKHPNCHLENIGLEACA
LTGACCEDLASSFTHCKTLLGINLQENALDHSGLVALFEAMKQQQCTVNLRGLRITDFDK
ETQEFLMAEKEKNPYLSI
NT seq 2937 nt   +upstreamnt  +downstreamnt
atggcatcatttttttctgattttggccttatgtggtacttggaagagctaaacaagaaa
gaattcatgaaatttaaggaattactccaacaggagattttgcagttggggctgaaacac
atttcttggaccgaagtgaagaaggcatctcgtgaagaccttgccaacttactgttgaaa
cattatgaggagaagaaagcctgggatatgaccttcaaaatcttccagaagatgaatagg
caggatctcatggagagggcaggaagagagattgctggacactcaaagttatatcaagtt
catttgaagaagaagctgacccatgattatgccagaaagtttaacatcaaagatcaagat
tcccttaagcagaaatttacccaggatgactgtgatcattttgagaaccttctcatatca
aaggcgactggaaagaagccacacatggtgtttctgcaaggagtggcgggaattggcaag
tcactgatgttgacaaagttaatgcttgcctggtcagaaggcatggtgtttcagaacaaa
ttctcctacatcttctacttctgctgtcaagatgtgaagaagatgaagagagcaagcctg
gcagaattgatctccaaagagtggcccaacgcctcagctcccatagaggagatcctgtcc
caaccggagaaactcttatttgtcatcgacaacttggaagtgatggaatgtgatatgtct
gaatgggagtcggagctgtgtgatgactgcatggagaagcagccagtgaatatactgatg
agcagtttgctcaggaggaagatgctccctgaatcctctttcctcgtctctgctacccca
gagacttttgagaaaatagaggacaggattgagtgcacaaatgtaaaaatgatggcagga
ttcaatgagagcagtattaaggtgtatttctacagcttgttccaagataggaacagaacc
caggaaattttcagtttggtgagagaaaatgagcagctgttctctgtatgtcaagtccct
gtgctctgctggatggtggctacttgtctaaaaaaagagatagagaagggaagagaccca
gtctcaatctgccgacgtatcacttccctgtataccacttacatcttcaatttgttcatt
ccccacagtgcccaatatccaagtaagaaaagccaagaccagctgcagggcttatgttct
ctggctgctgagggcatgtggactgacacatttgtgtttgctgaggaggctctcaggaga
aatgggatcatggactctgatatctccacactgctggacgtaaggatccttgaaaagagc
aaggaatctgaaaaatcttacattttcctccacccatctatccaggaggtctgtgctgcc
atctttcatctgctaaagagccatgtagaccatcctagccaggatgtcaaaagtatagag
gcactcatatttacatttctaaagaaagtcaaaatacagtggattttttttggctctttc
atctttggccttttacatgaatcagaacaaaaaaagctagaggcattttttggccaccag
ttgtcccaagaaataaaacgtcagttgtatcagtgcctggaaaccataagtggcaataaa
gagcttcaagaacagatagatggcatgaagctgttttactgtctgtttgagatggacgat
gaagccttcttaccacaagttatgaactgtatggaacagattaaatttgtggctaaggat
tattctgatgttattgttgctgcccactgcttacaacactgttctacactgaaaaaacta
tccttgtcaacccagaatatcctgagtgaaggtcaagaacacagctatacggaaaagcta
ctcatctgttggcatcatgtgtgctctgtgctcacaagcagtaaggatatccacgtactc
caagtgaaagacactaatttcaatgaaagagcctttttggtcttgtatagtcatctgaag
taccccagctgcatccttaaagtacttgaggtaaataatgtgactttgctttgtgataac
cgcctgttatttgagttgattcagaaccaacgtttgcagctcttgaacctcagcctcaca
ttcctgtcccacaatgatgtgaaactgttgtgtgatgtcttgaaccaggcagagtgcaac
atagaaaagctgatggtagcagactgtaacctttcacctgatgactgcaaggtctttgtc
tccgtcctgatcagcagcaagatgttgaagcatcttaatttgtcatctaacaacttggac
aaagggatatcctctctgtccaaggctttgtgccacccagactgtgttctgaagaacttg
gtgttagccaaatgttccctcagtgaggaatgttggcactacctttcagaagttcttagg
cggaacaaaaccttgacccacctagatatcagcttcaatgacctaaaggacgaagggctg
aaggttctctgtggggctctcactctcccagacagtgtcctcatatcactgagtgtaaga
tattgtctcatcaccactagtggttgccaggacctggctgaagtcttgagaaacaaccag
aacctgaggaacctacagatttcaaacaataaaatagaagatgctggtgtgaagctcctg
tgtgatgctataaaacatcccaactgccacttagaaaatattggattggaagcctgcgca
ctaactggtgcctgctgtgaggaccttgcttcttcttttacccactgtaagaccctgttg
ggaatcaacctgcaggagaacgccttggaccacagtggattggttgcactgtttgaggct
atgaaacagcaacagtgtaccgtgaatttacgtggacttcgaattactgactttgataag
gaaacccaggagttcctgatggctgagaaagagaaaaacccatacttgagcatctaa

DBGET integrated database retrieval system