KEGG   Mus musculus (mouse): 50518
Entry
50518             CDS       T01002                                 

Gene name
a, A<y>, ASIP, ASP, As, ago
Definition
(RefSeq) nonagouti
  KO
K08725  agouti signaling protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    50518 (a)
SSDB
Motif
Pfam: Agouti Toxin_9
Other DBs
NCBI-GeneID: 50518
NCBI-ProteinID: NP_056585
MGI: 87853
Ensembl: ENSMUSG00000027596 ENSMUSG00000084897
Vega: OTTMUSG00000015981 OTTMUSG00000016002
UniProt: Q03288
LinkDB
Position
2 H1; 2 76.83 cM
AA seq 131 aa
MDVTRLLLATLVGFLCFFTVHSHLALEETLGDDRSLRSNSSMNSLDFSSVSIVALNKKSK
KISRKEAEKRKRSSKKKASMKKVARPPPPSPCVATRDSCKPPAPACCDPCASCQCRFFGS
ACTCRVLNPNC
NT seq 396 nt   +upstreamnt  +downstreamnt
atggatgtcacccgcctactcctggccaccctagtgggcttcctgtgcttcttcaccgtc
cacagccacctggcactcgaggagacgcttggagatgacaggagtctgcggagtaactcc
tccatgaactcgctggatttctcctctgtttctatcgtggcactgaacaagaaatccaag
aagatcagcagaaaagaagccgagaagcggaagaggtcttccaagaaaaaggcttcgatg
aagaaggtggcaaggcccccgccaccttcgccctgcgtggccacccgcgacagctgcaag
ccacccgcacccgcctgctgcgacccgtgcgcctcctgccagtgccgtttcttcggcagc
gcctgcacctgtcgagtactcaaccccaactgctga

DBGET integrated database retrieval system