KEGG   Mus musculus (mouse): 50772Help
Entry
50772             CDS       T01002                                 

Gene name
Mapk6, 2610021I23Rik, D130053K17Rik, Erk3, Mapk4, Mapk63, Prkm4, Prkm6
Definition
(RefSeq) mitogen-activated protein kinase 6
  KO
K06855  mitogen-activated protein kinase 4/6 [EC:2.7.11.24]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04657  IL-17 signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    50772 (Mapk6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    50772 (Mapk6)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     50772 (Mapk6)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   50772 (Mapk6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH
Motif
Other DBs
NCBI-GeneID: 50772
NCBI-ProteinID: NP_056621
MGI: 1354946
Ensembl: ENSMUSG00000042688
Vega: OTTMUSG00000037218
UniProt: Q61532
LinkDB All DBs
Position
9 D; 9 42.3 cM
AA seq 720 aa AA seqDB search
MAEKFESLMNIHGFDLGSRYMDLKPLGCGGNGLVFSAVDNDCDKRVAIKKIVLTDPQSVK
HALREIKIIRRLDHDNIVKVFEILGPSGSQLTDDVGSLTELNSVYIVQEYMETDLANVLE
QGPLLEEHARLFMYQLLRGLKYIHSANVLHRDLKPANLFINTEDLVLKIGDFGLARIMDP
HYSHKGHLSEGLVTKWYRSPRLLLSPNNYTKAIDMWAAGCIFAEMLTGKTLFAGAHELEQ
MQLILDSIPVVHEEDRQELLSVIPVYIRNDMTEPHRPLTQLLPGISREALDFLEQILTFS
PMDRLTAEEALSHPYMSIYSFPTDEPISSHPFHIEDEVDDILLMDETHSHIYNWERYHDC
QFSEHDWPIHNNFDIDEVQLDPRALSDVTDEEEVQVDPRKYLDGDREKYLEDPAFDTSYS
AEPCWQYPDHHENKYCDLECSHTCNYKTRSSPYLDNLVWRESEVNHYYEPKLIIDLSNWK
EQSKEKSDKRGKSKCERNGLVKAQIALEEASQQLAERERGQGFDFDSFIAGTIQLSAQHQ
SADVVDKLNDLNSSVSQLELKSLISKSVSREKQEKGRANLAQLGALYQSSWDSQFVSGGE
ECFLISQFCCEVRKDEHAEKENTYTSYLDKFFSRKEDSEMLETEPVEEGKRGERGREAGL
LSGGGEFLLSKQLESIGTPQFHSPVGSPLKSIQATLTPSAMKSSPQIPHKTYSSILKHLN
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaaattcgaaagtctcatgaacattcatggctttgatctgggctctaggtac
atggacttaaaaccattgggctgcggaggcaatggcttggtcttttctgctgtagacaat
gactgtgacaaaagagtagccatcaagaaaattgtcctcaccgatccccagagtgtcaaa
catgctctccgtgaaatcaaaattattcgaagacttgaccacgataacattgtgaaagtg
tttgaaattcttggtcccagtggaagccagttaacagacgatgtgggctctctcacggag
ctgaatagcgtctacattgttcaggagtatatggagacagacttggcgaatgtgctggag
cagggccctttactggaagagcatgccaggcttttcatgtatcagctgctacgtgggctc
aaatatatccattctgcaaacgtactgcacagagatctcaagccagctaatcttttcatt
aacactgaagacttggtgctgaagataggtgactttggcctggcacggatcatggatcct
cattattcccataagggtcatctttctgaaggattggttaccaaatggtacagatctcca
cggcttttactttctcctaataattacactaaagccattgacatgtgggctgcaggctgc
atctttgctgagatgctgactggtaaaaccctctttgcaggtgcacatgaacttgaacag
atgcagctgatcctcgactccatccctgttgtgcacgaggaggatcggcaggagcttctc
agcgtgattccagtttacattagaaacgacatgactgagccacacagaccgctcactcag
ctgctgccggggatcagccgagaagcactggatttcctggagcagattctgactttcagc
cccatggaccggctgacagctgaggaagccctttcccatccttacatgagcatctactcc
ttcccgacggatgagcccatctcaagccaccctttccacatagaggacgaagtggacgac
attttgcttatggatgaaacacacagtcacatttataactgggaaaggtaccacgattgt
cagttctcggagcatgactggcctattcataacaactttgatatcgatgaggtgcagctt
gacccaagagctctgtctgacgtcaccgatgaagaagaagtccaagttgatcctcgaaaa
tacttggatggagaccgagagaagtatctagaggatcccgccttcgacaccagctactct
gctgaaccctgctggcagtacccagatcaccacgagaacaagtactgcgatctggagtgt
agccacacctgtaactacaaaacaagatcatcaccatacttagataacctggtgtggagg
gagagcgaggttaaccattactatgagcccaagcttattatagatctttccaactggaaa
gagcaaagtaaagaaaaatccgataagagaggcaagtccaagtgtgagaggaacgggttg
gtcaaggcgcagatcgcgctagaggaagcatcccagcagctggctgagagggagaggggc
caaggcttcgactttgactccttcatcgcggggaccattcagctcagtgcccagcatcag
tctgctgacgtagttgacaagttaaacgacttgaatagctcagtgtcccagctagaattg
aaaagcctgatatccaagtcagtcagccgagaaaagcaagaaaagggaagggctaacctg
gcccagctgggagccttgtaccagtcctcctgggacagccagtttgtgagtggcggggag
gagtgcttcctcatcagtcagttttgttgtgaggtcaggaaggacgagcatgcggagaag
gagaacacctacaccagctatttggacaagttttttagcaggaaggaggattccgaaatg
ctagaaactgagccagtggaggaagggaagcgtggggagagaggccgtgaggcagggctt
ctgagcggcggtggggagttcctcctgagcaagcagctggagtccataggcaccccgcag
ttccacagcccagtggggtccccactcaagtccatccaggccaccttgacaccttccgct
atgaaatcttcccctcaaatccctcacaagacatacagcagcattctgaaacatctgaac
taa

DBGET integrated database retrieval system