KEGG   Mus musculus (mouse): 50868Help
Entry
50868             CDS       T01002                                 

Gene name
Keap1, INRF2, mKIAA0132
Definition
(RefSeq) kelch-like ECH-associated protein 1
  KO
K10456  kelch-like protein 19
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04120  Ubiquitin mediated proteolysis
mmu05200  Pathways in cancer
mmu05225  Hepatocellular carcinoma
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    50868 (Keap1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    50868 (Keap1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    50868 (Keap1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    50868 (Keap1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    50868 (Keap1)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     50868 (Keap1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Kelch_1 Kelch_6 BACK Kelch_3 BTB Kelch_2 Kelch_4 Kelch_5
Motif
Other DBs
NCBI-GeneID: 50868
NCBI-ProteinID: NP_001103775
MGI: 1858732
Ensembl: ENSMUSG00000003308
Vega: OTTMUSG00000050608
UniProt: Q9Z2X8
LinkDB All DBs
Structure
PDB: 

Position
9; 9 A3
AA seq 624 aa AA seqDB search
MQPEPKLSGAPRSSQFLPLWSKCPEGAGDAVMYASTECKAEVTPSQDGNRTFSYTLEDHT
KQAFGVMNELRLSQQLCDVTLQVKYEDIPAAQFMAHKVVLASSSPVFKAMFTNGLREQGM
EVVSIEGIHPKVMERLIEFAYTASISVGEKCVLHVMNGAVMYQIDSVVRACSDFLVQQLD
PSNAIGIANFAEQIGCTELHQRAREYIYMHFGEVAKQEEFFNLSHCQLATLISRDDLNVR
CESEVFHACIDWVKYDCPQRRFYVQALLRAVRCHALTPRFLQTQLQKCEILQADARCKDY
LVQIFQELTLHKPTQAVPCRAPKVGRLIYTAGGYFRQSLSYLEAYNPSNGSWLRLADLQV
PRSGLAGCVVGGLLYAVGGRNNSPDGNTDSSALDCYNPMTNQWSPCASMSVPRNRIGVGV
IDGHIYAVGGSHGCIHHSSVERYEPERDEWHLVAPMLTRRIGVGVAVLNRLLYAVGGFDG
TNRLNSAECYYPERNEWRMITPMNTIRSGAGVCVLHNCIYAAGGYDGQDQLNSVERYDVE
TETWTFVAPMRHHRSALGITVHQGKIYVLGGYDGHTFLDSVECYDPDSDTWSEVTRMTSG
RSGVGVAVTMEPCRKQIDQQNCTC
NT seq 1875 nt NT seq  +upstreamnt  +downstreamnt
atgcagcccgaacccaagcttagcggggctccccgcagcagccagttcctgcccctgtgg
tcaaagtgccccgagggggccggggacgcagtgatgtatgcctccacggagtgcaaggca
gaggtgacgccctcgcaggacggtaaccgaaccttcagctacacactagaggatcacacc
aagcaggcttttggcgtcatgaacgagcttcgcctgagccagcaactctgtgacgtgacc
ctgcaggtcaaatatgaggacatcccagctgcccaattcatggctcacaaagtggtgctg
gcctcctccagcccagtctttaaagccatgttcaccaacgggcttcgggagcagggcatg
gaggtggtgtccatcgaaggcatccaccctaaggtcatggaaaggcttattgagttcgcc
tacacggcctccatctccgtgggcgagaagtgtgtcctgcacgtgatgaacggggcggtc
atgtaccagattgacagcgtggttcgagcctgcagcgacttcctcgtgcagcagctggac
cccagcaacgccattggcatcgccaacttcgcggagcagatcggctgcactgaactgcac
cagcgtgcccgggagtatatctacatgcacttcggggaggtggccaagcaggaggagttc
ttcaacctgtcacactgccagctggccacgctcatcagccgggatgatctgaacgtacgc
tgcgagtccgaggtgttccacgcgtgcatcgactgggtcaaatacgactgcccgcagcgg
cgcttctacgtgcaggcactgctgcgggccgtgcgctgccatgcgctcacgccgcgcttc
ctgcagacgcagctgcagaagtgtgagatcctgcaggccgacgcgcgctgcaaggactac
ctggtgcagatattccaggagctcacgctgcacaagcccacgcaggcagtgccctgccgc
gcgcccaaagtgggccgcctcatctacacagcgggcggttacttccgacagtcgctcagc
tacctggaggcctacaacccgagcaatggctcctggctgcgcctggccgatctacaggtg
ccgcgcagtgggctggcaggctgcgtggtgggtgggctgctatacgctgtgggcggccgc
aacaactctccggatggcaacactgactccagcgccctggactgctacaaccccatgacc
aaccagtggtcgccctgtgcctctatgagcgtgccacgcaaccgcatcggggtgggggtc
atagatggccacatctacgcagtcgggggttcccacggctgcatccaccacagcagcgtg
gagagatatgagccagagcgggacgagtggcatctagtcgcgccaatgttgacacggagg
attggcgtgggcgtggcagtgctcaaccgcttgctgtatgcagtggggggctttgacggg
actaaccggcttaactccgcagaatgttactatccagagaggaatgagtggcggatgatc
acaccgatgaataccatccggagcggggccggggtctgcgtgctgcacaactgtatctat
gcagcagggggctacgatgggcaggaccagttgaacagtgtggagcgctacgacgtggag
acagagacctggactttcgtagcccccatgaggcatcaccgtagtgcgctggggattact
gtgcaccagggcaagatctacgtcctcggaggctatgatggccacacttttctggacagt
gtggaatgctatgacccggacagtgatacctggagtgaggtgacccgcatgacatctggc
cgcagcggggtgggtgtggccgtcaccatggaaccctgtcggaagcaaattgatcaacaa
aactgtacctgctga

DBGET integrated database retrieval system