KEGG   Mus musculus (mouse): 50877Help
Entry
50877             CDS       T01002                                 

Gene name
Neu3
Definition
(RefSeq) neuraminidase 3
  KO
K12357  sialidase-2/3/4 [EC:3.2.1.18]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00511  Other glycan degradation
mmu00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    50877 (Neu3)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    50877 (Neu3)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     50877 (Neu3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BNR_2 BNR_3 BNR
Motif
Other DBs
NCBI-GeneID: 50877
NCBI-ProteinID: NP_057929
MGI: 1355305
Ensembl: ENSMUSG00000035239
Vega: OTTMUSG00000059050
UniProt: Q9JMH7 Q543I9
LinkDB All DBs
Position
7; 7 E1
AA seq 418 aa AA seqDB search
MEEVPPYSLSSTLFQQEEQSGVTYRIPALLYLPPTHTFLAFAEKRTSVRDEDAACLVLRR
GLMKGRSVQWGPQRLLMEATLPGHRTMNPCPVWEKNTGRVYLFFICVRGHVTERCQIVWG
KNAARLCFLCSEDAGCSWGEVKDLTEEVIGSEVKRWATFAVGPGHGIQLHSGRLIIPAYA
YYVSRWFLCFACSVKPHSLMIYSDDFGVTWHHGKFIEPQVTGECQVAEVAGTAGNPVLYC
SARTPSRFRAEAFSTDSGGCFQKPTLNPQLHEPRTGCQGSVVSFRPLKMPNTYQDSIGKG
APATQKCPLLDSPLEVEKGAETPSATWLLYSHPTSKRKRINLGIYYNRNPLEVNCWSRPW
ILNRGPSGYSDLAVVEEQDLVACLFECGEKNEYERIDFCLFSDHEVLSCEDCTSPSSD
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atggaggaagtcccaccctactccctcagcagcaccctgttccagcaggaagaacagagt
ggggtgacctaccggatcccagccctgctgtaccttcctcccacccacaccttcctggcc
tttgcagagaagcggacctcagtcagagatgaggatgctgcctgcctggtgctcagacga
gggctgatgaaggggcgctctgtacagtggggcccccaacggctactgatggaggccaca
ttacctgggcatcgcaccatgaacccctgccctgtgtgggagaaaaatactggccgtgtg
tacctgtttttcatctgtgtgcggggccatgttactgagaggtgccagattgtgtggggc
aaaaatgccgcccgtctctgcttcctttgcagtgaagatgccggctgctcttggggtgaa
gtgaaagacttgaccgaggaggtcattggctcagaggtgaagcgctgggccacatttgct
gtgggcccaggtcatggcatccagctacactcgggaaggctgatcatccccgcctatgcc
tactatgtctcacgttggtttctctgctttgcgtgttcagtcaagccccattccctgatg
atctacagtgatgactttggagtcacatggcaccatggcaagttcattgagccccaggtg
acaggggagtgccaagtggccgaagtggctgggacggctggtaaccctgtgctctactgc
agtgcccgaacaccaagccgatttcgagcagaggcttttagtactgatagtggtggctgc
tttcagaagccaaccctgaacccacaactccatgagcctcgaaccggctgccaaggtagt
gtagtgagcttccggcctttgaagatgccaaatacctatcaagactcaattggcaaaggt
gctcccgctactcagaagtgccctctgctggacagtcctctggaggtggagaaaggagct
gaaacaccatcagcaacatggctcttgtactcacatccaactagcaagaggaagaggatt
aacctaggcatctactacaaccggaaccccttggaggtgaactgctggtcccgcccgtgg
atcttgaaccgtgggcccagtggctactctgatctggctgttgtggaagaacaggacttg
gtggcgtgtttgtttgagtgtggggagaagaatgagtatgagcggattgacttctgtctg
ttttcagaccatgaggtcctgagctgtgaagactgtaccagccctagtagcgactaa

DBGET integrated database retrieval system