KEGG   Mus musculus (mouse): 50930Help
Entry
50930             CDS       T01002                                 

Gene name
Tnfsf14, HVEM-L, HVEML, LIGHT, LTg, Ly113, Tnlg1d
Definition
(RefSeq) tumor necrosis factor (ligand) superfamily, member 14
  KO
K05477  tumor necrosis factor ligand superfamily member 14
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04061  Viral protein interaction with cytokine and cytokine receptor
mmu04064  NF-kappa B signaling pathway
mmu05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    50930 (Tnfsf14)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    50930 (Tnfsf14)
   04061 Viral protein interaction with cytokine and cytokine receptor
    50930 (Tnfsf14)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    50930 (Tnfsf14)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    50930 (Tnfsf14)
   04090 CD molecules [BR:mmu04090]
    50930 (Tnfsf14)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Tumor necrosis fators
   50930 (Tnfsf14)
CD molecules [BR:mmu04090]
 Proteins
  50930 (Tnfsf14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNF PhoR
Motif
Other DBs
NCBI-GeneID: 50930
NCBI-ProteinID: NP_062291
MGI: 1355317
Ensembl: ENSMUSG00000005824
UniProt: Q9QYH9 A0A0U5JAA8
LinkDB All DBs
Position
17; 17 D
AA seq 239 aa AA seqDB search
MESVVQPSVFVVDGQTDIPFRRLEQNHRRRRCGTVQVSLALVLLLGAGLATQGWFLLRLH
QRLGDIVAHLPDGGKGSWEKLIQDQRSHQANPAAHLTGANASLIGIGGPLLWETRLGLAF
LRGLTYHDGALVTMEPGYYYVYSKVQLSGVGCPQGLANGLPITHGLYKRTSRYPKELELL
VSRRSPCGRANSSRVWWDSSFLGGVVHLEAGEEVVVRVPGNRLVRPRDGTRSYFGAFMV
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atggagagtgtggtacagccttcagtgtttgtggtggatggacagacggacatcccattc
aggcggctggaacagaaccaccggagacggcgctgtggcactgtccaggtcagcctggcc
ctggtgctgctgctaggtgctgggctggccactcagggctggtttctcctgagactgcat
caacgtcttggagacatagtagctcatctgccagatggaggcaaaggctcctgggagaag
ctgatacaagatcaacgatctcaccaggccaacccagcagcacatcttacaggagccaac
gccagcttgataggtattggtggacctctgttatgggagacacgacttggcctggccttc
ttgaggggcttgacgtatcatgatggggccctggtgaccatggagcccggttactactat
gtgtactccaaagtgcagctgagcggcgtgggctgcccccaggggctggccaatggcctc
cccatcacccatggactatacaagcgcacatcccgctacccgaaggagttagaactgctg
gtcagtcggcggtcaccctgtggccgggccaacagctcccgagtctggtgggacagcagc
ttcctgggcggcgtggtacatctggaggctggggaagaggtggtggtccgcgtgcctgga
aaccgcctggtcagaccacgtgacggcaccaggtcctatttcggagctttcatggtctga

DBGET integrated database retrieval system