KEGG   Mus musculus (mouse): 51869Help
Entry
51869             CDS       T01002                                 

Gene name
Rif1, 5730435J01Rik, 6530403D07Rik, AU016181, AW549474, D2Ertd145e
Definition
(RefSeq) replication timing regulatory factor 1
  KO
K11138  telomere-associated protein RIF1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    51869 (Rif1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mmu03032]
    51869 (Rif1)
DNA replication proteins [BR:mmu03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     51869 (Rif1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rif1_N 4_1_CTD
Motif
Other DBs
NCBI-GeneID: 51869
NCBI-ProteinID: NP_780447
MGI: 1098622
Ensembl: ENSMUSG00000036202
Vega: OTTMUSG00000012437
UniProt: Q6PR54
LinkDB All DBs
Position
2 C1.1; 2 29.98 cM
AA seq 2426 aa AA seqDB search
MTAPGRSPLEPLLETWEDPSVPPGEQTDAYLTLTSRMTGEEGKEVIAEIEKNLSRLYTVL
KAHISSQNSELSSAALQALGFCLYNPRITSGLSEANIQELLLTLNGIIKSSDKNVCTRAL
WVISKQTFPAELVSKMVSSIIDSLEVILSKGEIHSAVVDFEALNVIISHWFLHCRLIEQA
PVQMGEESVRWAKLVIPLVVHSAQKVHLRGATALEMGMPLLLQKQQEIALITEHLMTTKL
ISELQKLFKNKNETYVLKLWPLFVKLLGKTLHRSGSFINSLLQLEELGFRSGTPMIKKIA
FIAWKSLIDNFALNPDILCSAKRLKLLMQPLSSIHVRTETLALTKLEVWWYLLMRLGPQL
PANFEQVCVPLIQSTISVDSIPSPQGNSSRGSASPGLSPLTPGHKGASPYGSPRGNLSSN
TGGMAAIPSIQLLGLEMMLHFLLGPEVLSFAKQHKIVLSLEPLEHPLISSPSFFSKYAHT
LITAVHDSFVSVGKDASDAVVSAIWKELISLVKSVTEAGNRKEKSGSEVLTLLLKSLENI
VKSEVFPVSKTLVLMEITVKGLPPKVLGSPAYQVANMDILNGTPALFLIQLIFNNNLLEC
GVEDEKFFLNLETLVGCVLSGPTSPLAFSDSVLTVINQNAKQLVNKEHLWRMWSMIVSPL
TDVIHQTNEVNQGDALEHNFSAIYGALTLPINHIFSAQTFPTGTMKALLKTWSELYRAFT
RCASLVATAEENLCCEELSSKIMCSLEDEVLSDLLFLDRISHIIIVMVDCIDFSPYNKKY
QPKIKSPQRSSDWSRKKKEPLGKLASLFKLIVKVIDTFHTLSLKETFSDTLLAIGNSIIS
MLSNVFGHISLPSMIREIFATFTRPLALLYENSKLDEAPKVYTSLNNKLEKLLGEIVACL
QFSYLGAYDSELLEHLSPLLCVIFLHKNKQIRKQSALLWNATFAKATALVYPEELKPILR
QAKQKILLLLPGLENVEMMDESSEPYSESTENSQLNVKISGMERKSSGKRDSILAHTKDK
KKKVKLSAKLKLESSSPKIKSGKLLEEEKSTDFVFIPPEGKETKARVLTEHQKEVLKTKR
CDIPALYNNLDASQDTLFSAQFSQEESMESLTLTEKPKEDAKIIKEEQMESTIFIHQDAP
ENCGIDEHSENASLPNCGGSVAETNPETLITGFDARKEVLISSKILSAESSSSTETSVVS
SSSVSNATFSGTPPQPTSRRQTFITLEKFDGSETRPFSPSPLNNISSTVTVRNNQDNTTN
TDMPPKARKREVTNSKSDSENLANAGKKSSRRWSKAEQSVTKKSKPSLTSEQEEHSSENN
SPDLLSPTEHVSENDDHPSEATLEHKDGDPKPAVENASLEDLTTEEKNVGINMESKESTA
SVVARTEQIVNEDSQAAALAPNPKTLRRSSRRRSEAVDSCSDSQERESGQQKKERRKEEE
KIISKSPLRIKDDKLPTQKLTDESPIQENLTEKGNTLPERTSGEPSVNAEIDQNRRKPDL
ENVSSEGGGGTLDNLDKSSEKPLRGRTRYQTRRASQGLISAVENSESDSSEAKEEVSRKK
RSGKWKNRSSDSVDIEEQEEKKAEEEVMKTANQTLDGQAVPDVDVNAAAQVCEKSTNNNR
VILQDSAGPADSLQAPPKGEEKSKINKCVDSSFVSLPVPESNLRTRNASKRLLYKQDNDS
NVRVSDSSLSPEKFTQVECQHKRSRRVRRSKSCDCCGEKSQSQEKSFIGLKNTESYAIKS
VEKKKTDLQVPETAPETREARDHAETKLAGEEPLVNFHVGLKEENCTTGDSVKSEAELQE
ASLPPEIVTVKEKTYDTDASEAVSEIQGPCSENHSPAEDPGLSECKDISQKQLSENGELD
ISDVGKACKVIAGSSPEGVETMELNVRNDAFVAADSEKSTQMDVSVDVATEEDNKKDECE
AVTTEVNVEGVATEDFNSGMDLSDTPIPVSKDVETEHAASGEIEGESNESDSGSCEEMNK
EMGSHKAQMSTEIDSARVKETDILASASKSEEALIGRLDVNTQSFVSDIEMSSGERTVNC
KTETSIELNKLDEAKLSGNEATVGNDTLQEVCFTSEKVEKLPQCLLVQVASELGAESNTT
SPEKLELDSFGSVNESPSGMQQARCVWSPLASPSTSILKRGLKRSQEDEISPVNKIRRVS
FADPIYQAGLADDIDRRCSVVRSHSSNSSPIIKSVKTSPTSHSKHNTTSAKGFLSPGSQS
SKFKSPKKCLITEMAQESMLSPTESVYPALVNCAASVDIILPQITSNMWARGLGQLIRAK
NIKTIGDLSTLTASEIKTLPIRSPKVFNVKKALRVYHEQQMKSRGLEEIPIFDISEKAVN
GVESRTVSTDEERFASDLIEPVTLDTPLSKNLVAQISALALQLDSEDLYSYTGSQLFEMH
EKLGTMANSIIRNLQSRWRSPAHENS
NT seq 7281 nt NT seq  +upstreamnt  +downstreamnt
atgacggccccaggtcgcagccccctggagccgcttctggagacttgggaagacccctcg
gtgcctccgggagagcagacggacgcctacctaactctgaccagtcgtatgactggagaa
gaaggaaaagaagtcattgcagaaatcgagaaaaacctttctcggctgtacacggtttta
aaggctcacatttccagtcagaactcagaactgagcagtgctgctttgcaagccttggga
ttttgtttatataatcccagaattacctcaggattgtcagaggcaaatattcaagaactg
cttttaaccttgaatggtatcattaagagttcagacaaaaatgtgtgtaccagggcactg
tgggtaatatccaaacagacgtttcctgctgaacttgttagcaaaatggtatccagtatt
attgattcattggaagtgatactaagtaaaggagagatacattctgctgttgttgatttt
gaagcattaaatgttattataagtcattggtttcttcattgtaggctaattgaacaagcc
ccagttcaaatgggagaagagtctgtgaggtgggccaaattggtcataccattagttgtt
cactcagcacaaaaagtacatttgcggggagccactgctctagagatggggatgccattg
ctgcttcagaaacaacaagaaatagccttgattacagagcaccttatgactactaaatta
atctcagaactccaaaaactatttaagaataaaaatgagacttatgtgttaaaactatgg
cctttgtttgtcaaacttcttggaaagaccttgcaccgaagtgggagtttcatcaactct
ttgttacagctggaagaactgggcttccgtagtggaacacccatgattaaaaaaatcgct
ttcattgcttggaaaagcttaatagataattttgctttaaacccagatatactttgtagt
gcaaaaagactgaagttgttaatgcaacccttgagttccatccatgtgagaacagaaact
ttagcattaacaaaactagaagtctggtggtatttactgatgagacttggacctcagctc
cctgccaattttgaacaggtgtgcgtgccactgattcagagtacaataagtgttgatagt
attccttcacctcaaggcaattcatctcgagggtctgcttctccaggcttaagtccactg
actccgggacataaaggtgcttctccttatggaagtccccgtgggaacctgagttcaaat
acaggtggaatggctgcaatcccttctattcagcttttgggactggaaatgatgcttcat
tttttgttgggcccagaagttttgagttttgccaagcaacacaagattgtattgagttta
gagccactggaacacccgctaatcagcagcccttctttcttctccaagtatgcgcataca
cttatcactgctgttcatgatagctttgtctcagttggaaaggatgcctcagatgcagta
gtcagtgctatctggaaggagctaattagcttggtgaagtcagttactgaagcaggaaac
agaaaagaaaaatcaggttctgaagttttgacccttctactaaaatctttggaaaacata
gtgaagtcagaagtatttcctgtatcaaaaacactggttctcatggaaattacagttaaa
ggacttcctccgaaagtactaggttcaccagcatatcaggttgctaatatggatattctt
aatggaactccagcattgtttttaatccagttaattttcaacaacaatcttttagaatgt
ggtgtagaagatgagaagttttttctcaatctagaaacacttgtaggctgtgtactttct
ggtccaacatcaccactggcttttagtgattctgttctaactgtgattaatcagaatgca
aagcagttggtaaacaaggagcatctctggagaatgtggagtatgatagtcagtccactg
actgatgtgattcaccagaccaatgaagtgaatcaaggcgatgccttagaacataatttt
agtgccatctatggtgcattgactttaccaataaaccatattttttcagctcagacattt
cccacgggtaccatgaaagctttacttaaaacttggtcagaattgtatagagcatttact
cgctgtgcttctttggtggcaacagcagaagagaatctgtgctgtgaagaactttcttct
aaaataatgtgcagtttggaagatgaagtcctttcagatttgctattcttggacaggatc
tctcatattattattgtaatggttgattgtatcgacttttcaccatataataagaaatac
cagccaaaaatcaaatcaccgcagagatcttcagattggtccagaaagaagaaggagcct
ctagggaaattggcttctttatttaagctaattgtgaaagtcatcgatactttccacact
ctaagcctcaaggaaacattctctgatacactgcttgctattggtaactctatcattagc
atgctttccaatgtatttggacatatttccttgccctctatgatccgagaaatatttgca
acttttacaagacctctggctttactgtatgaaaactcaaagctggatgaggctcctaaa
gtgtatactagtctgaacaacaagttagaaaagctattgggagaaattgttgcatgccta
cagttcagctatcttggagcctatgacagtgaacttcttgaacatctttctccactcctg
tgcgtaatatttcttcacaagaataaacagattcggaaacagagtgctctgttgtggaat
gccacatttgctaaagcgacagctctggtttatcctgaggaattaaaaccaatattaaga
caagccaaacagaaaattttgcttctgctgcctggtttggaaaatgttgaaatgatggat
gagtccagtgaaccgtattcagaatcaacagagaattcacaattaaatgtcaagataagt
ggcatggaaagaaaatcaagtggaaaaagagattccattttggcacatacaaaggataaa
aaaaaaaaagtgaaactgtcggccaaactgaaactagaatcttcatctccaaaaataaag
agtggtaagcttttggaagaggaaaagtctaccgactttgtcttcattcctccagaagga
aaagagacaaaggcaagggttctaactgagcatcagaaagaagtactcaaaacaaaacgg
tgtgatattcctgccttgtataataatctggatgcttcacaggacactttattttctgct
cagtttagtcaagaagaatcaatggaaagcctcactttaactgaaaaaccaaaagaagat
gccaagataattaaggaagagcaaatggaaagtactattttcatccatcaagatgccccg
gagaactgtggaatagatgaacattctgagaatgcttctttaccaaattgtggtggctct
gttgctgaaaccaatccagaaacattgatcactggttttgatgctagaaaagaagtatta
atttcatcaaagatattgtctgctgaaagttcatctagtacagaaacttcggtggtcagc
agtagttcagtttctaatgccactttttctggaactcctccacagcctacaagtcggaga
caaacctttattactttggagaaatttgatggctcagaaactagaccttttagtccatcc
cccttgaataacatatcttccactgttacagtgagaaataaccaggataacacaactaac
actgacatgccaccaaaagcaaggaaaagagaagtgacgaactcaaaatctgattcagaa
aatttagcgaatgcaggtaagaaatcaagtcggagatggagtaaagctgagcagtcagtt
actaaaaagtctaagccatcactgacatctgaacaggaagagcactcatccgaaaataac
tctcctgatctgctcagcccaacagaacatgtgtcagaaaatgatgatcatccttctgaa
gctaccctagagcataaagatggagatcctaaaccagcagtagaaaatgcttcattggaa
gacttaacaacagaagagaaaaatgtaggcattaatatggaatctaaagaaagtacagcc
tcagttgtagcacgaacagaacaaatagtaaatgaagatagtcaggctgctgcactagcc
ccaaatccaaaaacactccgacggtcttcgaggcggcgttcagaagctgtagattcttgc
agtgacagccaagagagagagagtggtcagcaaaaaaaggaaagacgaaaggaagaagaa
aaaataatctccaagagtccgttgcgtatcaaagatgataagttgcccacgcaaaaacta
actgatgagtcacctatacaggaaaatttaactgaaaagggaaatactttacctgagaga
acttcaggggaacccagtgttaatgctgaaattgaccaaaatagaagaaaaccagacctt
gagaatgttagttctgaaggaggtggtggtaccctggacaatctagacaagtcgtctgag
aaacctttaagaggacggacacgttatcaaacaagaagagcttcgcagggtttgatttct
gctgttgaaaactcagaatctgacagttctgaggcaaaggaagaagtttctagaaagaaa
cgatcagggaaatggaaaaatagaagcagtgacagtgttgacattgaagaacaagaagaa
aaaaaggctgaagaggaagttatgaaaactgcaaatcagacactcgatggccaggcagtt
cctgatgttgatgtaaatgcagcggctcaggtttgtgaaaaaagtacaaataacaacagg
gtcatcctccaggattctgctgggcctgcagattcactgcaagctccacccaaaggcgag
gagaaaagtaagattaacaaatgtgtagacagttcatttgtaagtctacctgtgccagag
tcaaacctcaggactaggaatgccagtaagagattattatataaacaagataatgatagt
aatgtgagggtatcagacagctctctgtctcccgaaaaattcacccaagttgaatgccaa
cacaagagaagtaggagagtcaggagatctaaaagttgtgactgctgtggcgaaaaatca
cagtcccaggaaaagtcatttattgggttaaagaacacagaaagttatgctataaagagt
gtggagaaaaaaaagacagatctacaagtacctgagactgcccctgaaactcgtgaagct
cgtgaccatgctgaaacaaagttggcaggcgaagagcctcttgtgaattttcatgtgggt
cttaaagaagagaattgtactactggtgattcagttaagtctgaggctgagttgcaagaa
gcttcccttccacctgaaatagtaactgtgaaagagaagacttacgatacagacgctagt
gaagcagtgtctgaaatccaagggccatgtagtgagaaccacagccctgctgaggaccca
ggcttaagtgagtgcaaagacatttcacagaagcagctttcagagaacggagagcttgac
atcagcgatgtagggaaggcatgcaaagtcatagctgggtccagtccagagggagttgaa
actatggaattaaatgtaagaaatgatgcatttgtagctgctgactctgaaaagagtacc
caaatggatgtttctgtagatgtggcaacagaggaagataataaaaaagatgaatgtgaa
gcagtcacaactgaagtgaatgttgaaggagtagccactgaggactttaattcaggtatg
gatctttctgatactcccatacctgtaagcaaggatgttgagactgagcacgcagctagt
ggggaaatagagggggagagcaatgaatctgattcaggctcatgtgaggaaatgaacaaa
gaaatgggaagtcacaaagcccagatgagcactgaaattgacagtgccagggtaaaggag
acggacatacttgccagtgcctctaaatctgaagaagcgctgattggaagactagacgtc
aacacccagagctttgttagtgacattgaaatgagttctggagaaagaactgttaattgc
aaaactgagacatccattgaacttaataaattagatgaagcaaaattaagtggcaatgaa
gctacagtgggaaatgatactctgcaggaagtttgctttacttcagagaaagtggagaaa
ttaccacagtgtctgctagttcaagtggcttctgaacttggagcagaaagcaatactacg
tctcccgaaaagttagagctggattcttttggatcagtaaatgaaagtcctagtggtatg
cagcaggcacgttgtgtctggtcacctttggcttctccatccacaagcattttaaagaga
ggactaaaaagatcccaagaagatgagatctcaccagttaacaagattagacgtgtctcg
tttgcagatccaatataccaagcaggattggcagatgacattgataggcgttgctctgtt
gttagatctcattcttcaaatagctctcccataataaaaagtgttaaaacttcacctact
tcacactctaagcataataccacttcagccaaaggatttctgtccccaggatcacagagc
tctaaatttaagagcccaaagaagtgtttaattacagaaatggcccaagaatccatgctg
tccccaacagaaagtgtttacccagctttggtgaactgtgcagcatcagttgacatcatt
ttacctcagattacatcaaatatgtgggcaagaggtcttgggcaactcatcagagccaag
aatataaaaaccattggggatttgagtacgcttacggcatctgaaataaaaactctgcct
atccgttctccaaaggtgtttaatgtaaaaaaggccctcagagtataccatgagcaacag
atgaaatctcgtggacttgaagaaattccaatttttgatatttctgagaaggcagtaaat
ggagtggagagcaggactgtctccacggatgaagaaaggttcgcctcagatttgattgaa
cctgtgaccctagataccccattgtctaaaaatcttgtggcacaaattagtgctcttgct
cttcaactggactcagaagatctctacagttacactggaagccagctatttgaaatgcat
gaaaaacttggtaccatggcaaactctataataagaaatctacagtcacgttggagatca
ccagcccatgaaaattcttag

DBGET integrated database retrieval system