KEGG   Mus musculus (mouse): 53857Help
Entry
53857             CDS       T01002                                 

Gene name
Tuba8
Definition
(RefSeq) tubulin, alpha 8
  KO
K07374  tubulin alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04145  Phagosome
mmu04210  Apoptosis
mmu04530  Tight junction
mmu04540  Gap junction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    53857 (Tuba8)
  09143 Cell growth and death
   04210 Apoptosis
    53857 (Tuba8)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    53857 (Tuba8)
   04540 Gap junction
    53857 (Tuba8)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    53857 (Tuba8)
   03036 Chromosome and associated proteins [BR:mmu03036]
    53857 (Tuba8)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    53857 (Tuba8)
   04147 Exosome [BR:mmu04147]
    53857 (Tuba8)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     53857 (Tuba8)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Other tubulins
     53857 (Tuba8)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulins
    53857 (Tuba8)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   53857 (Tuba8)
  Exosomal proteins of other body fluids (saliva and urine)
   53857 (Tuba8)
  Exosomal proteins of colorectal cancer cells
   53857 (Tuba8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tubulin Tubulin_C Tubulin_3
Motif
Other DBs
NCBI-GeneID: 53857
NCBI-ProteinID: NP_059075
MGI: 1858225
Ensembl: ENSMUSG00000030137
Vega: OTTMUSG00000022202
UniProt: Q9JJZ2
LinkDB All DBs
Position
6; 6 F1
AA seq 449 aa AA seqDB search
MRECISVHVGQAGVQIGNACWELFCLEHGIQADGTFGTQASKINDDDSFTTFFSETGNGK
HVPRAVMVDLEPTVVDEVRAGTYRQLFHPEQLITGKEDAANNYARGHYTVGKESIDLVLD
RIRKLTDACSGLQGFLIFHSFGGGTGSGFTSLLMERLSLDYGKKSKLEFAIYPAPQVSTA
VVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITA
SLRFDGALNVDLTEFQTNLVPYPRIHFPLVTYAPIISAEKAYHEQLSVAEITSSCFEPNS
QMVKCDPRHGKYMACCMLYRGDVVPKDVNVAIAAIKTKRTIQFVDWCPTGFKVGINYQPP
TVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSE
AREDLAALEKDYEEVGTDSFEEENEGEEF
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgagggaatgcatatcggtccatgtgggtcaagccggagttcagattggcaatgcctgc
tgggagctcttctgcttggagcacggcatccaggcggatggaacctttggcactcaggcc
agcaagatcaacgatgacgactcctttaccaccttcttcagtgagactggcaacgggaaa
cacgtgccccgggctgtcatggtggacctggagcctaccgtagtagatgaggtgcgggca
ggaacctaccgccagctcttccatcctgagcagctgatcacaggcaaggaggatgcagct
aacaattacgcccgcgggcactatacggtgggcaaggagagtatcgatctggtgctggac
cgaatccgtaaactgactgatgcctgctccggcttgcagggcttcctcatcttccacagc
tttggtgggggcacaggatctggctttacttctctgctgatggagcgcctttccctagac
tatggcaagaagtccaagctggaatttgccatctacccagccccccaggtctccacagca
gtggtggagccttacaactccatcctgaccacccataccaccctggaacattccgactgt
gctttcatggtggataacgaagccatctacgacatctgccgcaggaacctggatattgaa
cgccccacctataccaacctcaaccgcctcatcagccagattgtgtcctccatcactgcc
tctctccgctttgatggcgccctcaatgtggacctcacagagtttcagaccaacctggta
ccctacccccgaatccacttcccgctggtcacttacgcccccatcatttctgctgagaaa
gcctaccacgagcagctgtctgtggcagagataactagctcctgtttcgagcccaacagc
cagatggtgaagtgtgacccacgtcatggcaaatacatggcctgctgcatgctctaccgc
ggtgatgtggtacccaaggacgtgaatgtcgccattgctgccatcaagaccaagagaact
attcagtttgttgactggtgtcccacaggtttcaaggtgggcatcaactaccagccacct
actgtcgtgccaggaggggacctggccaaagtccagcgagccgtgtgcatgctgagcaac
accacagcaatcgcagaggcctgggcccgccttgaccataagtttgacctcatgtacgcc
aagcgggcctttgtacattggtatgttggagagggtatggaagaaggagagttttctgag
gccagggaggacctggctgctctggagaaggattatgaagaagtggggactgattcgttt
gaagaagagaatgagggggaggaattttaa

DBGET integrated database retrieval system