KEGG   Mus musculus (mouse): 53859Help
Entry
53859             CDS       T01002                                 

Gene name
Map3k14, Nik, aly
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 14
  KO
K04466  mitogen-activated protein kinase kinase kinase 14 [EC:2.7.11.25]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04064  NF-kappa B signaling pathway
mmu04210  Apoptosis
mmu04380  Osteoclast differentiation
mmu04625  C-type lectin receptor signaling pathway
mmu04660  T cell receptor signaling pathway
mmu04668  TNF signaling pathway
mmu04672  Intestinal immune network for IgA production
mmu05166  Human T-cell leukemia virus 1 infection
mmu05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    53859 (Map3k14)
   04064 NF-kappa B signaling pathway
    53859 (Map3k14)
   04668 TNF signaling pathway
    53859 (Map3k14)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    53859 (Map3k14)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    53859 (Map3k14)
   04660 T cell receptor signaling pathway
    53859 (Map3k14)
   04672 Intestinal immune network for IgA production
    53859 (Map3k14)
  09158 Development
   04380 Osteoclast differentiation
    53859 (Map3k14)
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05166 Human T-cell leukemia virus 1 infection
    53859 (Map3k14)
   05169 Epstein-Barr virus infection
    53859 (Map3k14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    53859 (Map3k14)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     53859 (Map3k14)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: STE group
  Other
   53859 (Map3k14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal APH
Motif
Other DBs
NCBI-GeneID: 53859
NCBI-ProteinID: NP_058592
MGI: 1858204
Ensembl: ENSMUSG00000020941
Vega: OTTMUSG00000003049
UniProt: Q9WUL6 Q544K4
LinkDB All DBs
Structure
PDB: 

Position
11 E1; 11 66.8 cM
AA seq 942 aa AA seqDB search
MAVMEVACPGTPGSAVGQQKELAKAKEKTQSLGKKQSCIFKLEAVEKSPVFCGKWEILND
VITKGTAKDGSEGGPPAISIIAQAECENSQEFSPTFSERIFIAGSQQYSQSESLDQIPNN
VAHATEGKMARVCRRGKRHGKARKKRRKKRSKSLAQAGVALAKPLPRTPEQESCTIPVQE
DESPLGNLYARNVSQFTKPLGGPGLGHLCFKKQDEGLRPVLPRPELHKLISPLQCLNHVW
KLHHPQATGPRPHPTHPFPYSGMPHPFPFYPLEPWKPYMLDSAVLDKLAGVSGQRPLPGP
PHLSQLAHGDSQKPLPGPHLESSCPSRGALEKVPVEEYLVHALQGSVSSGQAHSLASLAK
TWSSGSAKLQRLGPETEDNEGVLLTEKLKPVDYEYREEVHWMTHQPRVGRGSFGEVHRMK
DKQTGFQCAVKKVRLEVFRVEELVACAGLSSPRIVPLYGAVREGPWVNIFMELLEGGSLG
QLIKQMGCLPEDRALYYLGQALEGLEYLHTRRILHGDVKADNVLLSSDGSRAALCDFGHA
LCLQPDGLGKSLLTGDYIPGTETHMAPEVVMGKPCDAKVDIWSSCCMMLHMLNGCHPWTQ
YFRGPLCLKIASEPPPIREIPPSCAPLTAQAIQEGLRKEPVHRASAMELRRKVGKALQEV
GGLKSPWKGEYKEPRPPPQDQATCHQTLPTPPRENPPAKANTDGAPEPQPPLPPEPPEPS
KAPALNLSKEESGTWEPLPLSSLDPATAKGPSFPDRRATLPELELQQLEIELFLNSLSQP
FSLEEQEQILSCLSIDSLSLSDDSEKNPSKASQSSRDTLSSGVHSWNSQAEARTCSCSTA
LARGRPTDIPSYFNGVKVQIQSLNGEHLHIREFHRVKVGDIATGISSQIPATAFSLVTKD
GQPVCYDMEVPDSGIDLQCTLAPDGSFAWTWRVKHGQLENRP
NT seq 2829 nt NT seq  +upstreamnt  +downstreamnt
atggccgtgatggaagtggcctgcccgggcactcctgggtcagcagtcgggcagcagaag
gagcttgccaaagccaaggagaagacacagtcactggggaagaagcagagctgcatcttc
aagcttgaggccgtggagaagagccccgtgttctgtgggaagtgggagatcctaaacgac
gtgatcaccaaaggcacagccaaggacggctctgagggaggaccaccggccatctccatc
atcgcccaggctgaatgtgagaatagccaagagttcagccccaccttctcagagcgcatt
ttcatcgcggggtcacagcagtacagccagtctgagagtctcgatcaaatccccaacaat
gtggcccatgcaactgaaggcaaaatggcccgtgtgtgccggaggggaaaacgtcacggc
aaagcccgaaaaaaacgtaggaagaagaggtcgaagtcactggcccaggcaggagtggcc
ttagccaagcccctgcccagaacccctgagcaagagagctgtaccatcccagtacaggaa
gatgagtctccactaggcaacctctatgccagaaatgtctcccagttcaccaagcctctg
gggggaccaggccttggccacctgtgctttaagaaacaagatgaaggcctgcgaccggta
ctgcctcgaccagaactccacaaactgatcagccccttgcaatgtctaaaccacgtgtgg
aaactccaccacccccaggccacaggcccccggccccacccgactcaccccttcccctac
agcggaatgccccatcctttcccattctaccccctggagccctggaaaccctatatgctg
gactctgccgtcctggacaaactagccggtgtcagcggccagcggcctctgcctggccca
ccgcatctaagccaactggcccatggagacagtcagaagccgctgcctggcccacacctg
gagtccagctgcccgtctcggggtgccctagaaaaggttcccgtggaggaatacctggtg
catgcgctccaaggaagtgtgagctcaggccaggcccacagcctggccagcctggctaag
acatggtcctcgggaagcgccaagctgcagaggctcggccccgaaactgaggacaacgag
ggggtcctgcttactgagaaactcaagccagtggattatgagtatcgagaagaggtccac
tggatgacacaccagcctcgggtgggcagaggctccttcggcgaggtccacagaatgaag
gacaagcagacaggcttccagtgtgctgtcaaaaaggtacgactcgaggtgtttcgggta
gaggaactagtggcctgtgctggtctgagctcgcccagaatcgtccctctctatggagct
gtgagagaaggcccgtgggtgaacatcttcatggaactgctagaaggtggctcgctgggt
cagctcataaagcaaatgggctgtctgccagaagaccgagccctttactacctgggccag
gccctggaggggctggagtacctccacacacgcaggattctgcatggcgatgtcaaagct
gacaacgtgctcctgtccagtgatggaagccgagcggccctctgcgactttggccacgcc
ttgtgcctgcaacctgacggcctagggaaatccttgctcacaggggactacattcctggc
acggagacccacatggcaccagaagtggtgatgggaaagccctgcgatgccaaggtggac
atctggagcagctgctgcatgatgctccacatgctcaacggctgccacccctggactcag
tacttccgaggcccgctttgtctcaagattgccagcgagcctccaccgatcagggagatc
ccaccttcctgcgcacccctcacagcccaggccatccaagaggggctgaggaaagagccc
gtccaccgagcatctgccatggagcttcggaggaaagtgggcaaggcactacaggaagtg
ggaggtctgaaaagcccttggaaaggagaatataaagaaccaagacctccaccccaagac
caagccacctgccaccagaccctacctactccgccgagagagaacccaccagccaaggcc
aacacagacggggctcctgagcctcagcctcctctaccgccagaaccaccagaaccgagc
aaagcgccagccctgaacctgagcaaggaggagtctggcacatgggaacccctgcctctg
tcctccctggacccagccactgccaaaggccccagcttcccagaccggagggcaaccttg
ccagagctggagctacagcaactggagatagaactgtttctcaacagcctgtcccagccg
ttctctctggaggaacaggaacaaatcctctcctgcctcagcatcgacagcctctcgctg
tcagatgacagtgaaaagaatccatcgaaggcctctcagagctcacgggacaccctgagt
tctggcgtgcactcttggaacagccaagctgaggcaagaacctgcagctgcagcacggcg
ctggcccgggggcggcctactgacatcccgagctacttcaacggggtcaaggtccagatc
cagtctctcaatggcgaacacctgcatatccgggaattccaccgcgtcaaggtgggagac
attgccaccggcatcagcagccagatcccagccacagctttcagcctggtgaccaaagat
ggacagcctgtttgctatgacatggaggtgccagactcgggcatcgacctgcagtgcacc
ctggcccctgatggcagctttgcttggacctggagggtcaagcatggtcagctggagaac
cgaccctag

DBGET integrated database retrieval system