KEGG   Mus musculus (mouse): 54123
Entry
54123             CDS       T01002                                 

Gene name
Irf7
Definition
(RefSeq) interferon regulatory factor 7
  KO
K09447  interferon regulatory factor 7
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04620  Toll-like receptor signaling pathway
mmu04621  NOD-like receptor signaling pathway
mmu04622  RIG-I-like receptor signaling pathway
mmu04623  Cytosolic DNA-sensing pathway
mmu05160  Hepatitis C
mmu05161  Hepatitis B
mmu05162  Measles
mmu05164  Influenza A
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    54123 (Irf7)
   04621 NOD-like receptor signaling pathway
    54123 (Irf7)
   04622 RIG-I-like receptor signaling pathway
    54123 (Irf7)
   04623 Cytosolic DNA-sensing pathway
    54123 (Irf7)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    54123 (Irf7)
  09172 Infectious disease: viral
   05161 Hepatitis B
    54123 (Irf7)
   05160 Hepatitis C
    54123 (Irf7)
   05164 Influenza A
    54123 (Irf7)
   05162 Measles
    54123 (Irf7)
   05168 Herpes simplex virus 1 infection
    54123 (Irf7)
   05167 Kaposi sarcoma-associated herpesvirus infection
    54123 (Irf7)
   05169 Epstein-Barr virus infection
    54123 (Irf7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    54123 (Irf7)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters interferon-regulating factors
    54123 (Irf7)
SSDB
Motif
Pfam: IRF-3 IRF
Other DBs
NCBI-GeneID: 54123
NCBI-ProteinID: NP_058546
MGI: 1859212
Ensembl: ENSMUSG00000025498
Vega: OTTMUSG00000024538
UniProt: P70434 Q542T3
LinkDB
Structure
PDB: 
3QU3

Position
7; 7 F5
AA seq 457 aa
MAEVRGVQRVLFGDWLLGEVSSGQYEGLQWLNEARTVFRVPWKHFGRRDLDEEDAQIFKA
WAVARGRWPPSGVNLPPPEAEAAERRERRGWKTNFRCALHSTGRFILRQDNSGDPVDPHK
VYELSRELGSTVGPATENREEVSLSNALPTQGVSPGSFLARENAGLQTPSPLLSSDAGDL
LLQVLQYSHILESESGADPVPPQAPGQEQDRVYEEPYAAWQVEAVPSPRPQQPALTERSL
GFLDVTIMYKGRTVLQAVVGHPRCVFLYSPMAPAVRTSEPQPVIFPSPAELPDQKQLHYT
ETLLQHVSPGLQLELRGPSLWALRMGKCKVYWEVGSPMGTTGPSTPPQLLERNRHTPIFD
FSTFFRELEEFRARRRQGSPHYTIYLGFGQDLSAGRPKEKTLILVKLEPWVCKAYLEGVQ
REGVSSLDSSSLGLCLSSTNSLYEDIEHFLMDLGQWP
NT seq 1374 nt   +upstreamnt  +downstreamnt
atggctgaagtgaggggggtccagcgagtgctgtttggagactggctattgggggaggtc
agcagcggccagtacgaggggctgcagtggctgaacgaggctcgcacagtcttccgcgta
ccctggaagcatttcggtcgtagggatctggatgaagaagatgcacagatcttcaaggcc
tgggctgtggcccgagggaggtggccacctagtggagttaacctgccacccccagaggct
gaggctgctgagcgaagagagcgaagaggctggaagaccaacttccgctgtgcactccac
agcacagggcgttttatcttgcgccaagacaattcaggggatccagttgatccgcataag
gtgtacgaacttagccgggagcttggatctactgtgggcccagccacggaaaatagggaa
gaagtgagcctcagcaatgctctgcccacacagggtgtgtccccaggatcatttctggca
agagaaaatgctgggctccaaaccccaagccctctgctttctagtgatgccggggacctc
ttgcttcaggttctgcagtacagccacatactggaatccgagtctggggcagaccccgtc
ccaccacaggctcctggccaggagcaagaccgtgtttacgaggaaccctatgcagcatgg
caggtggaagctgtccccagtcccaggcctcaacagccagctctcaccgagcgcagcctt
gggttcctggatgtgaccatcatgtacaagggccgcacagtgctacaggcagtggtgggg
caccccagatgcgtgttcctgtacagccccatggccccagcagtaagaacttcagagccc
cagccggtgatctttcccagtcctgctgagctcccagatcagaagcagctgcactacaca
gagacgcttctccagcatgtgtctcccggccttcagctggagcttcgaggaccgtcactg
tgggccctgcgtatgggcaagtgcaaggtgtactgggaggtaggcagccctatgggcact
accggcccctccaccccaccccagctgctggagcgcaaccgccacacccccatcttcgac
ttcagcactttcttccgagaactggaggagtttcgggctcggaggcggcaagggtcacca
cactacaccatctacctgggttttgggcaagacttgtcagcagggaggcccaaggagaag
accctgatcctggtgaagctggagccatgggtatgcaaggcatacctggagggcgtgcag
cgtgagggtgtgtcctccctggacagcagcagtctcggcttgtgcttgtctagcaccaac
agtctctacgaagacatcgaacacttcctcatggacctgggtcagtggccttga

DBGET integrated database retrieval system