KEGG   Mus musculus (mouse): 54131
Entry
54131             CDS       T01002                                 

Gene name
Irf3, C920001K05Rik, IRF, IRF-3
Definition
(RefSeq) interferon regulatory factor 3
  KO
K05411  interferon regulatory factor 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04620  Toll-like receptor signaling pathway
mmu04621  NOD-like receptor signaling pathway
mmu04622  RIG-I-like receptor signaling pathway
mmu04623  Cytosolic DNA-sensing pathway
mmu05133  Pertussis
mmu05135  Yersinia infection
mmu05160  Hepatitis C
mmu05161  Hepatitis B
mmu05162  Measles
mmu05163  Human cytomegalovirus infection
mmu05164  Influenza A
mmu05165  Human papillomavirus infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05171  Coronavirus disease - COVID-19
mmu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    54131 (Irf3)
   04621 NOD-like receptor signaling pathway
    54131 (Irf3)
   04622 RIG-I-like receptor signaling pathway
    54131 (Irf3)
   04623 Cytosolic DNA-sensing pathway
    54131 (Irf3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    54131 (Irf3)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    54131 (Irf3)
   05133 Pertussis
    54131 (Irf3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    54131 (Irf3)
   05161 Hepatitis B
    54131 (Irf3)
   05160 Hepatitis C
    54131 (Irf3)
   05171 Coronavirus disease - COVID-19
    54131 (Irf3)
   05164 Influenza A
    54131 (Irf3)
   05162 Measles
    54131 (Irf3)
   05168 Herpes simplex virus 1 infection
    54131 (Irf3)
   05163 Human cytomegalovirus infection
    54131 (Irf3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    54131 (Irf3)
   05169 Epstein-Barr virus infection
    54131 (Irf3)
   05165 Human papillomavirus infection
    54131 (Irf3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    54131 (Irf3)
   04131 Membrane trafficking [BR:mmu04131]
    54131 (Irf3)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters interferon-regulating factors
    54131 (Irf3)
Membrane trafficking [BR:mmu04131]
 Autophagy
  Other autophagy associated proteins
   TRIM-directed selective autophagy
    54131 (Irf3)
SSDB
Motif
Pfam: IRF-3 IRF
Other DBs
NCBI-GeneID: 54131
NCBI-ProteinID: NP_058545
MGI: 1859179
Ensembl: ENSMUSG00000003184
Vega: OTTMUSG00000020438
UniProt: P70671 Q3U9K6
LinkDB
Position
7; 7 B3
AA seq 419 aa
METPKPRILPWLVSQLDLGQLEGVAWLDESRTRFRIPWKHGLRQDAQMADFGIFQAWAEA
SGAYTPGKDKPDVSTWKRNFRSALNRKEVLRLAADNSKDPYDPHKVYEFVTPGARDFVHL
GASPDTNGKSSLPHSQENLPKLFDGLILGPLKDEGSSDLAIVSDPSQQLPSPNVNNFLNP
APQENPLKQLLAEEQWEFEVTAFYRGRQVFQQTLFCPGGLRLVGSTADMTLPWQPVTLPD
PEGFLTDKLVKEYVGQVLKGLGNGLALWQAGQCLWAQRLGHSHAFWALGEELLPDSGRGP
DGEVHKDKDGAVFDLRPFVADLIAFMEGSGHSPRYTLWFCMGEMWPQDQPWVKRLVMVKV
VPTCLKELLEMAREGGASSLKTVDLHISNSQPISLTSDQYKAYLQDLVEDMDFQATGNI
NT seq 1260 nt   +upstreamnt  +downstreamnt
atggaaaccccgaaaccgcggattttgccctggctggtgtcacagctggacctggggcag
ctggaaggcgtggcctggctggacgagagccgaacgaggttcaggatcccgtggaagcat
ggcctacggcaggacgcacagatggctgactttggcatcttccaggcctgggcagaagcc
agtggtgcctacaccccggggaaggataagccggacgtgtcaacctggaagaggaatttc
cggtcagccctgaaccggaaagaagtgttgcggttagctgctgacaatagcaaggaccct
tatgaccctcataaagtgtatgagtttgtgactccaggggcgcgggacttcgtacatctg
ggtgcctctcctgacaccaatggcaaaagcagcctgcctcactcccaggaaaacctaccg
aagttatttgatggcctgatcttggggcccctcaaagatgaggggtcctcagatctggct
attgtttctgatccttctcaacaactgccaagccccaatgtgaacaacttcctaaaccct
gcaccccaagaaaatccactgaagcagctgctagctgaggaacaatgggagttcgaggtg
accgccttctaccgaggccgccaggtcttccagcagacactcttttgcccggggggcctg
cggctggtgggcagcacagctgacatgacactgccctggcagccagtcaccctgcccgat
cctgaggggtttctgacggacaagcttgtgaaggagtacgtggggcaggtgctcaaaggg
ctgggcaatgggctggcactgtggcaggctgggcagtgcctctgggcccagcgcctaggc
cactcccacgccttctgggctctgggggaggagctgcttccagacagtgggcgagggcct
gatggagaggtccacaaggacaaggacggagccgtgttcgacctcaggcccttcgtggca
gatctgattgccttcatggaaggaagtggacactccccacgctacactctgtggttctgc
atgggggaaatgtggccccaggaccagccatgggtcaagaggcttgtgatggtcaaggtt
gttcctacatgtcttaaggagctgttagagatggcccgggaagggggagcctcttcactg
aaaaccgtggacttgcacatctccaacagccagcctatctcccttacctctgaccagtac
aaggcctacctccaggacttggtggaggacatggacttccaggccactggaaatatctga

DBGET integrated database retrieval system