KEGG   Mus musculus (mouse): 54354Help
Entry
54354             CDS       T01002                                 

Gene name
Rassf5, 1300019G20Rik, Maxp1, Nore1, Nore1A, Nore1B, Rapl
Definition
(RefSeq) Ras association (RalGDS/AF-6) domain family member 5
  KO
K08015  Ras association domain-containing protein 5
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04218  Cellular senescence
mmu04670  Leukocyte transendothelial migration
mmu05200  Pathways in cancer
mmu05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    54354 (Rassf5)
   04015 Rap1 signaling pathway
    54354 (Rassf5)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    54354 (Rassf5)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    54354 (Rassf5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    54354 (Rassf5)
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    54354 (Rassf5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Nore1-SARAH RA C1_1 C1_2 LexA_DNA_bind Mst1_SARAH
Motif
Other DBs
NCBI-GeneID: 54354
NCBI-ProteinID: NP_061220
MGI: 1926375
Ensembl: ENSMUSG00000026430
Vega: OTTMUSG00000021554
UniProt: Q5EBH1
LinkDB All DBs
Structure
PDB: 

Position
1 E4; 1 56.91 cM
AA seq 413 aa AA seqDB search
MASPAIGQRPYPLLLDPEPPRYLQSLGGTEPPPPARPRRCIPTALIPAAGASEDRGGRRS
GRRDPEPTPRDCRHARPVRPGLQPRLRLRPGSHRPRDVRSIFEQPQDPRVLAERGEGHRF
VELALRGGPGWCDLCGREVLRQALRCANCKFTCHSECRSLIQLDCRQKGGPALDRRSPES
TLTPTLNQNVCKAVEETQHPPTIQEIKQKIDSYNSREKHCLGMKLSEDGTYTGFIKVHLK
LRRPVTVPAGIRPQSIYDAIKEVNPAATTDKRTSFYLPLDAIKQLHISSTTTVSEVIQGL
LKKFMVVDNPQKFALFKRIHKDGQVLFQKLSIADYPLYLRLLAGPDTDVLSFVLKENETG
EVEWDAFSIPELQNFLTILEKEEQDKIHQLQKKYNKFRQKLEEALRESQGKPG
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atggcttccccggccatcgggcaacgtccctacccgctgctcctagatcccgagccgccg
cggtatctgcagagtctgggtggcaccgagccgccacctcccgcccggccgcgccgctgc
atccccacggccctgatccccgcggccggggcgtcagaggatcgcggtggcaggaggagt
ggccggagggaccccgaacccacgccccgagactgccgacacgctcgccctgtccggccc
ggtctgcagccgagactgcggctgcgacctgggtcacaccgaccccgcgacgtgaggagc
atcttcgagcagccgcaggatccccgcgtcttggccgagagaggcgaggggcaccgtttc
gtggaactggcgctgcggggcggtccgggctggtgtgacctgtgcggacgagaggtgctg
cggcaggcgctgcgctgcgctaattgtaaattcacctgccactcggagtgccgcagcctg
atccagctggactgcagacagaaggggggccctgccctggatagacgctctccagaaagc
accctcaccccaaccttgaaccagaatgtctgtaaggcagtggaggagacacagcacccg
cccacgatacaggagatcaagcagaagattgacagctataacagcagggagaagcactgc
ctgggcatgaagctgagtgaagatggcacctacacaggtttcatcaaagtgcatttgaag
ctccgacggccagtgacggtgcccgctgggatccggccccagtccatctatgatgccatt
aaggaagtgaaccctgcagccaccacagacaagcggacttccttctacctgccactcgat
gccatcaagcagctacatatcagcagcaccaccacggttagtgaggtcatccaggggctg
ctcaagaagttcatggttgtggacaacccacagaagtttgcactttttaagcggatacac
aaagatggacaagtgctcttccagaaactctccattgctgactatcctctctaccttcgt
ctgctcgctgggcctgacaccgatgttctcagctttgtgctaaaggagaatgaaactgga
gaggtggagtgggatgccttttccattcctgaactccagaactttttaactatcctggaa
aaagaggagcaggacaagatccatcaactgcaaaagaagtacaacaaattccgtcagaaa
ctggaagaggcattacgagagtcccaagggaagccggggtaa

DBGET integrated database retrieval system