KEGG   Mus musculus (mouse): 545486Help
Entry
545486            CDS       T01002                                 

Gene name
Tubb1, 2810484G07Rik, M(beta)1
Definition
(RefSeq) tubulin, beta 1 class VI
  KO
K07375  tubulin beta
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04145  Phagosome
mmu04540  Gap junction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    545486 (Tubb1)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    545486 (Tubb1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    545486 (Tubb1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    545486 (Tubb1)
   04147 Exosome [BR:mmu04147]
    545486 (Tubb1)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Other tubulins
     545486 (Tubb1)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulins
    545486 (Tubb1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   545486 (Tubb1)
  Exosomal proteins of colorectal cancer cells
   545486 (Tubb1)
  Exosomal proteins of bladder cancer cells
   545486 (Tubb1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tubulin Tubulin_C Misat_Tub_SegII Tubulin_2 Tubulin_3 ART
Motif
Other DBs
NCBI-GeneID: 545486
NCBI-ProteinID: NP_001074440
MGI: 107814
Ensembl: ENSMUSG00000016255
Vega: OTTMUSG00000016460
UniProt: A2AQ07
LinkDB All DBs
Position
2; 2 H4
AA seq 451 aa AA seqDB search
MREIVHIQIGQCGNQIGAKFWEVIGEEHGIDCAGSYCGTSALQLERISVYYNEAYGKKYV
PRAVLVDLEPGTMDSIRSSRLGVLFQPDSFVHGNSGAGNNWAKGHYTEGAELIENVMDVV
RRESESCDCLQGFQIVHSLGGGTGSGMGTLLMNKIREEYPDRILNSFSVMPSPKVSDTVV
EPYNAVLSIHQLIENTDACFCIDNEALYDICFRTLRLTTPTYGDLNHLVSLTMSGITTSL
RFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTAQGSQQYRALSVAELTQQMFDARNIM
AACDPRRGRYLTVACIFRGKMSTKEVDQQLLSIQTRNSNCFVEWIPNNVKVAVCDIPPRG
LNMAATFLGNNTAIQELFTRVSEHFSAMFRRRAFVHWYTSEGMDISEFGEAESDIHDLVS
EYQQFQDVRAGLEDSEEDVEEAEVEAEDKDH
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgagagagatcgtgcacatccagattggccagtgtggcaaccagatcggagccaagttc
tgggaggtgatcggggaagaacatgggattgactgcgctgggagctactgtgggacgtct
gctctccagctggagaggatcagcgtttactacaacgaagcctacggtaagaagtatgtg
ccgcgagccgtccttgtggacctggaacccgggacaatggacagcatccgatccagcaga
ttgggagtcctctttcagcctgacagttttgttcatggtaactctggtgctggtaacaac
tgggcgaagggccactacacagagggagcggagctgatcgaaaatgtcatggatgtggta
aggagggagagcgagagctgcgactgcctacagggtttccagatcgtgcattctctgggt
ggaggcacgggctcaggcatgggcaccctgctcatgaacaagatcagggaggagtacccg
gatcggatcttgaactcctttagcgtcatgccatcacccaaggtatcagacacggtggta
gagccctacaatgccgtgctatccatccaccagctgatagagaacacagatgcctgcttc
tgcatcgacaacgaagcgctctatgacatttgtttccgcaccctgaggctgacgacaccc
acctacggggatctcaaccacctggtgtccttgaccatgagcggaatcacgacttcactg
cgctttcccggtcagctcaatgcagacctgcgcaagctggccgtgaatatggtgcccttt
cctcgtcttcacttcttcatgcctggcttcgctccactcacagcccagggtagccagcag
taccgagccctctcagtagcggagctcacccaacagatgttcgatgcccgcaacatcatg
gctgcctgtgaccctcgccgcggccgctacctgactgtggcttgtatattccggggtaag
atgtccaccaaggaagtggaccaacagctgctgtccattcagacaaggaacagcaactgc
tttgtggaatggattcccaacaatgtcaaggtagctgtgtgtgacatcccgccccgtggg
ctgaacatggcagctaccttcctgggcaacaatacagccatccaagagctcttcaccagg
gtctctgagcacttctcagctatgttcagaaggagagcttttgtgcactggtacaccagt
gaagggatggacataagtgaatttggggaagctgagagtgatatccatgacctggtgtct
gagtaccaacaattccaagatgtcagagcagggctagaggacagtgaagaggatgtggag
gaggcagaggtggaggcagaagacaaagatcattag

DBGET integrated database retrieval system