KEGG   Mus musculus (mouse): 56044Help
Entry
56044             CDS       T01002                                 

Gene name
Rala, 3010001O15Rik, AW322615, Ral, Rasl1
Definition
(RefSeq) v-ral simian leukemia viral oncogene A (ras related)
  KO
K07834  Ras-related protein Ral-A
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu05200  Pathways in cancer
mmu05210  Colorectal cancer
mmu05212  Pancreatic cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    56044 (Rala)
   04015 Rap1 signaling pathway
    56044 (Rala)
   04072 Phospholipase D signaling pathway
    56044 (Rala)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    56044 (Rala)
  09162 Cancer: specific types
   05210 Colorectal cancer
    56044 (Rala)
   05212 Pancreatic cancer
    56044 (Rala)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    56044 (Rala)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:mmu04031]
    56044 (Rala)
Membrane trafficking [BR:mmu04131]
 Exocytosis
  Tethering complex
   Exocyst complex assembly proteins
    56044 (Rala)
GTP-binding proteins [BR:mmu04031]
 Small (Monomeric) G-proteins
  Ras Family
   Ral
    56044 (Rala)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf RsgA_GTPase GTP_EFTU MMR_HSR1 AAA_25 ThiF ATP_bind_1
Motif
Other DBs
NCBI-GeneID: 56044
NCBI-ProteinID: NP_062364
MGI: 1927243
Ensembl: ENSMUSG00000008859
Vega: OTTMUSG00000017001
UniProt: P63321
LinkDB All DBs
Position
13 A2; 13 6.05 cM
AA seq 206 aa AA seqDB search
MAANKPKGQNSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGE
EVQIDILDTAGQEDYAAIRDNYFRSGEGFLCVFSITEMESFAATADFREQILRVKEDENV
PFLLVGNKSDLEDKRQVSVEEAKNRADQWNVNYVETSAKTRANVDKVFFDLMREIRARKM
EDSKEKNGKKKRKSLAKRIRERCCIL
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atggctgcaaacaagcccaagggtcagaattctttggccttacacaaagtcatcatggtg
ggcagtggtggtgtgggcaagtctgccctgactctgcagttcatgtacgacgagtttgta
gaggactatgaacctaccaaagcggacagctacaggaagaaggtagtcctggacggggaa
gaagtgcagatcgacatcttagatacagcggggcaggaggactatgctgcaattagagac
aactacttccgaagtggggagggattcctctgtgtcttctctatcacagagatggagtcc
ttcgcagctaccgcggacttcagggagcagattttaagagtaaaagaagatgagaatgtt
ccatttctcctggttggtaacaagtcagatctagaagataaaaggcaggtttctgtagaa
gaggcaaaaaacagagctgaccagtggaacgttaactatgtggagacgtctgctaaaacg
cgcgccaacgttgacaaggtattttttgatttaatgagggaaatacgagccagaaagatg
gaagacagcaaagaaaaaaatggaaaaaagaagaggaaaagtttagccaagagaatcaga
gaaagatgctgcattttataa

KEGG   Mus musculus (mouse): 64143Help
Entry
64143             CDS       T01002                                 

Gene name
Ralb, 5730472O18Rik
Definition
(RefSeq) v-ral simian leukemia viral oncogene B
  KO
K07835  Ras-related protein Ral-B
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu05200  Pathways in cancer
mmu05210  Colorectal cancer
mmu05212  Pancreatic cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    64143 (Ralb)
   04015 Rap1 signaling pathway
    64143 (Ralb)
   04072 Phospholipase D signaling pathway
    64143 (Ralb)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    64143 (Ralb)
  09162 Cancer: specific types
   05210 Colorectal cancer
    64143 (Ralb)
   05212 Pancreatic cancer
    64143 (Ralb)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    64143 (Ralb)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:mmu04031]
    64143 (Ralb)
Membrane trafficking [BR:mmu04131]
 Exocytosis
  Tethering complex
   Exocyst complex assembly proteins
    64143 (Ralb)
GTP-binding proteins [BR:mmu04031]
 Small (Monomeric) G-proteins
  Ras Family
   Ral
    64143 (Ralb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf RsgA_GTPase SRPRB GTP_EFTU MMR_HSR1 Gtr1_RagA AAA_25 FeoB_N
Motif
Other DBs
NCBI-GeneID: 64143
NCBI-ProteinID: NP_071722
MGI: 1927244
Ensembl: ENSMUSG00000004451
Vega: OTTMUSG00000021776
UniProt: Q9JIW9 Q8CCG5
LinkDB All DBs
Position
1; 1 E2.3
AA seq 206 aa AA seqDB search
MAANKGKSQGSLVLHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGE
EVQIDILDTAGQEDYAAIRDNYFRSGEGFLLVFSITEHESFTATAEFREQILRVKSEEDK
IPLLVVGNKSDLEERRQVPVDEARGKAEEWGVQYVETSAKTRANVDKVFFDLMREIRAKK
MSENKDKNGRKSSKSKKSFKERCCLL
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atggctgccaacaagggcaagagccagggctccctggtacttcacaaggtcatcatggtt
ggcagtggaggggtcggcaaatcagccctgacgcttcagttcatgtatgatgagtttgta
gaagactatgagcccaccaaagctgacagttacagaaagaaggtggttctcgacggagaa
gaggtccagatagacatcctggacaccgctggccaggaggactatgcggccatccgtgac
aactacttccgaagcggagaaggctttctgctggtgttctccatcacagagcacgagtct
ttcacagccacagccgagttcagggaacagattctccgagtcaagtcagaggaggacaag
atcccactgctggtcgtgggcaacaagtccgacctggaggagcggaggcaggtgcctgtg
gacgaggcccgaggcaaagcggaggagtggggtgtgcagtacgtggagacatctgcaaag
acccgcgccaatgtggacaaggtattctttgatctgatgagagaaatccgggcaaaaaag
atgtcagaaaacaaggacaagaacggcaggaaaagcagcaagagcaagaaaagtttcaaa
gagcgatgctgcttgctgtga

DBGET integrated database retrieval system