KEGG   Mus musculus (mouse): 56289Help
Entry
56289             CDS       T01002                                 

Gene name
Rassf1, 123F2, AA536941, AU044980, NORE2A, RDA32, REH3P21, Rassf1A, Rassf1B, Rassf1C
Definition
(RefSeq) Ras association (RalGDS/AF-6) domain family member 1
  KO
K09850  Ras association domain-containing protein 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04014  Ras signaling pathway
mmu04390  Hippo signaling pathway
mmu04392  Hippo signaling pathway - multiple species
mmu05200  Pathways in cancer
mmu05206  MicroRNAs in cancer
mmu05219  Bladder cancer
mmu05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    56289 (Rassf1)
   04390 Hippo signaling pathway
    56289 (Rassf1)
   04392 Hippo signaling pathway - multiple species
    56289 (Rassf1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    56289 (Rassf1)
   05206 MicroRNAs in cancer
    56289 (Rassf1)
  09162 Cancer: specific types
   05219 Bladder cancer
    56289 (Rassf1)
   05223 Non-small cell lung cancer
    56289 (Rassf1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RA Nore1-SARAH C1_1 Mst1_SARAH
Motif
Other DBs
NCBI-GeneID: 56289
NCBI-ProteinID: NP_001230677
MGI: 1928386
Ensembl: ENSMUSG00000010067
Vega: OTTMUSG00000030554
UniProt: Q99MK9 A9YZW8 Q3UIV8
LinkDB All DBs
Position
9; 9 F1
AA seq 340 aa AA seqDB search
MSAEPELIELRELAPSGRIGPGRTRLERANALRIAPGTTRNPSQQHVPGRGHRFQPAGPT
THTWCDLCGDFIWGVVRKGLQCAHCKFTCHYRCRALVCLDCCGPRDLGWDSALERDTNVD
EAVERETPDLSQAETEQKIKDYNGQINSNLFMSLNKDGSYTGFIKVQLKLVRPVSVPSSK
KPPSLQDARRGTGRSTAVKRRTSFYLPKDAIKHLHVLSRTRAREVIEALLRKFMVVDDPR
KFALFERTERHGQVYLRKLSDDEQPLKLRLLAGPSEKALSFVLKENDSGEVNWDAFSMPE
LHNFLRILQREEEEHLRQILQKYSRCRQKIQEALHACPLG
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcggagccagaactcattgaactacgcgagctggcaccgtccgggcgcatcggt
ccaggccgtacccggctggagcgtgccaacgctctgcgcatcgccccgggtacaacacgc
aatccgtcacagcagcacgtcccgggtcgtggccaccgtttccagcctgcagggcccacc
acgcacacgtggtgcgacctctgtggagacttcatctggggcgtcgtgcgcaagggccta
cagtgcgcgcactgcaagttcacctgccattaccgttgtcgcgcgctcgtctgcttggac
tgctgcgggccccgagacctgggctgggactctgcactagagcgggatacgaacgtggat
gaggctgtagagcgggagacacccgatctttctcaagctgagactgagcagaaaatcaag
gactacaatggccagatcaacagcaacctcttcatgagcctgaataaggatggctcctac
acaggcttcatcaaggttcagctgaaactagtgcgtcctgtttcagtgccttccagcaag
aaaccaccttccttacaggacgcccggagaggtacggggcggagcacagccgtgaagcgc
cgcacctctttttacttgcctaaggatgctattaagcatctgcatgttctatcacgaaca
cgggcacgtgaggtcattgaggccctgcttcgaaaattcatggtcgtagatgatcctcgc
aagtttgcactctttgagcgaactgaacggcatggccaagtatacctccggaagctgtcg
gatgacgagcagcccttgaagctgcggcttcttgcagggcccagtgaaaaagccctgagc
tttgtcctgaaggaaaatgactcgggagaggtgaactgggatgccttcagcatgcctgaa
ctgcacaatttcctacgaatcctgcagcgggaagaagaggaacaccttcgccagatcctg
cagaagtattctcgttgtcgccagaagatccaggaggctctgcacgcctgtcctttgggg
tga

DBGET integrated database retrieval system