KEGG   Mus musculus (mouse): 56458Help
Entry
56458             CDS       T01002                                 

Gene name
Foxo1, AI876417, Afxh, FKHR, Fkhr1, Foxo1a
Definition
(RefSeq) forkhead box O1
  KO
K07201  forkhead box protein O1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04068  FoxO signaling pathway
mmu04152  AMPK signaling pathway
mmu04211  Longevity regulating pathway
mmu04213  Longevity regulating pathway - multiple species
mmu04218  Cellular senescence
mmu04910  Insulin signaling pathway
mmu04919  Thyroid hormone signaling pathway
mmu04922  Glucagon signaling pathway
mmu04931  Insulin resistance
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05202  Transcriptional misregulation in cancer
mmu05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    56458 (Foxo1)
   04152 AMPK signaling pathway
    56458 (Foxo1)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    56458 (Foxo1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    56458 (Foxo1)
   04922 Glucagon signaling pathway
    56458 (Foxo1)
   04919 Thyroid hormone signaling pathway
    56458 (Foxo1)
  09149 Aging
   04211 Longevity regulating pathway
    56458 (Foxo1)
   04213 Longevity regulating pathway - multiple species
    56458 (Foxo1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    56458 (Foxo1)
   05202 Transcriptional misregulation in cancer
    56458 (Foxo1)
  09162 Cancer: specific types
   05215 Prostate cancer
    56458 (Foxo1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    56458 (Foxo1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    56458 (Foxo1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    56458 (Foxo1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    56458 (Foxo1)
Transcription factors [BR:mmu03000]
 Eukaryotic Type
  Helix-turn-helix
   Fork head/winged helix other regulators
    56458 (Foxo1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FOXO_KIX_bdg Forkhead FOXO-TAD
Motif
Other DBs
NCBI-GeneID: 56458
NCBI-ProteinID: NP_062713
MGI: 1890077
Ensembl: ENSMUSG00000044167
Vega: OTTMUSG00000021250
UniProt: Q9R1E0
LinkDB All DBs
Position
3 C; 3 23.19 cM
AA seq 652 aa AA seqDB search
MAEAPQVVETDPDFEPLPRQRSCTWPLPRPEFNQSNSTTSSPAPSGGAAANPDAAASLAS
ASAVSTDFMSNLSLLEESEDFARAPGCVAVAAAAAASRGLCGDFQGPEAGCVHPAPPQPP
PTGPLSQPPPVPPSAAAAAGPLAGQPRKTSSSRRNAWGNLSYADLITKAIESSAEKRLTL
SQIYEWMVKSVPYFKDKGDSNSSAGWKNSIRHNLSLHSKFIRVQNEGTGKSSWWMLNPEG
GKSGKSPRRRAASMDNNSKFAKSRGRAAKKKASLQSGQEGPGDSPGSQFSKWPASPGSHS
NDDFDNWSTFRPRTSSNASTISGRLSPIMTEQDDLGDGDVHSLVYPPSAAKMASTLPSLS
EISNPENMENLLDNLNLLSSPTSLTVSTQSSPGSMMQQTPCYSFAPPNTSLNSPSPNYSK
YTYGQSSMSPLPQMPMQTLQDSKSSYGGLNQYNCAPGLLKELLTSDSPPHNDIMSPVDPG
VAQPNSRVLGQNVMMGPNSVMPAYGSQASHNKMMNPSSHTHPGHAQQTASVNGRTLPHVV
NTMPHTSAMNRLTPVKTPLQVPLSHPMQMSALGSYSSVSSCNGYGRMGVLHQEKLPSDLD
GMFIERLDCDMESIIRNDLMDGDTLDFNFDNVLPNQSFPHSVKTTTHSWVSG
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atggccgaagcgccccaggtggtggagaccgacccggacttcgagccgctgccccggcag
cgctcctgtacctggccgctgcccaggccggagtttaaccagtccaactcgaccacctcc
agtccggcgccgtcgggcggcgcggccgccaaccccgacgccgcggcgagcctggcctcg
gcgtccgctgtcagcaccgactttatgagcaacctgagcctgctggaggagagtgaggac
ttcgcgcgggcgccaggctgcgtggccgtggcggcggcggctgcggccagcaggggcctg
tgcggggacttccagggccccgaggcgggctgcgtgcacccagcgccgccacagccccca
ccgaccgggccgctgtcgcagcccccacccgtgcctccctccgctgccgccgccgcgggg
ccactcgcgggacagccgcgcaagaccagctcgtcgcgccgcaacgcgtggggcaacctg
tcgtacgccgacctcatcaccaaggccatcgagagctcagccgagaagaggctcaccctg
tcgcagatctacgagtggatggtgaagagcgtgccctacttcaaggataagggcgacagc
aacagctcggcgggctggaagaattcaattcgccacaatctgtcccttcacagcaagttt
attcgagtgcagaatgaaggaactggaaagagttcttggtggatgctcaatccagaggga
ggcaagagcggaaaatcaccccggagaagagctgcgtccatggacaacaacagtaaattt
gctaagagccgagggcgggctgctaagaaaaaagcatctctccagtctgggcaagagggt
cctggagacagccctgggtctcagttttctaagtggcctgcgagtcctgggtcccacagc
aacgatgactttgataactggagtacatttcgtcctcgaaccagctcaaatgctagtacc
atcagtgggagactttctcccatcatgacagagcaggatgacctgggagatggggacgtg
cattccctggtgtatccaccctctgctgccaagatggcgtctacgctgcccagtctgtct
gaaatcagcaatccagaaaacatggagaaccttctggataatctcaaccttctctcgtcc
ccaacatctttaactgtgtccacccagtcctcgcctggcagcatgatgcagcagacacca
tgctattcgtttgcaccgccaaacaccagtctaaattcacccagtccaaactactcaaag
tacacatacggccaatccagcatgagccctttgccccagatgcctatgcagacacttcag
gacagcaaatcaagttacggaggattgaaccagtataactgtgccccaggactcttgaaa
gagttgttgacttctgactctcctccccacaatgacattatgtcaccggttgatcccgga
gtggcccaacccaacagtcgggtcctgggccaaaatgtaatgatgggccctaattcggtc
atgccagcgtatggcagccaggcatctcataacaaaatgatgaaccccagctcccacacc
caccctggacatgcacagcaaacggcttcggtcaacggccgtaccctgccccatgtggtg
aacaccatgcctcacacatctgccatgaaccgcttgacccccgtgaagacacctttacaa
gtgcctctgtcccaccccatgcagatgagtgccctgggcagctactcctcggtgagcagc
tgcaatggctatggtaggatgggtgtcctccaccaggagaagctcccaagtgacttggat
ggcatgtttattgagcgcttggactgtgacatggagtccatcattcggaatgacctcatg
gatggagataccttggattttaactttgataatgtgttgcccaaccaaagcttcccacac
agtgtcaagactacaacacacagctgggtgtcaggctaa

DBGET integrated database retrieval system