KEGG   Mus musculus (mouse): 56489
Entry
56489             CDS       T01002                                 

Gene name
Ikbke, AW558201, IKK, IKK-E, IKK-i, IKKepsilon, Ikki
Definition
(RefSeq) inhibitor of kappaB kinase epsilon
  KO
K07211  inhibitor of nuclear factor kappa-B kinase subunit epsilon [EC:2.7.11.10]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04620  Toll-like receptor signaling pathway
mmu04621  NOD-like receptor signaling pathway
mmu04622  RIG-I-like receptor signaling pathway
mmu04623  Cytosolic DNA-sensing pathway
mmu04625  C-type lectin receptor signaling pathway
mmu04657  IL-17 signaling pathway
mmu05160  Hepatitis C
mmu05161  Hepatitis B
mmu05162  Measles
mmu05164  Influenza A
mmu05165  Human papillomavirus infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    56489 (Ikbke)
   04621 NOD-like receptor signaling pathway
    56489 (Ikbke)
   04622 RIG-I-like receptor signaling pathway
    56489 (Ikbke)
   04623 Cytosolic DNA-sensing pathway
    56489 (Ikbke)
   04625 C-type lectin receptor signaling pathway
    56489 (Ikbke)
   04657 IL-17 signaling pathway
    56489 (Ikbke)
 09160 Human Diseases
  09172 Infectious disease: viral
   05161 Hepatitis B
    56489 (Ikbke)
   05160 Hepatitis C
    56489 (Ikbke)
   05171 Coronavirus disease - COVID-19
    56489 (Ikbke)
   05164 Influenza A
    56489 (Ikbke)
   05162 Measles
    56489 (Ikbke)
   05168 Herpes simplex virus 1 infection
    56489 (Ikbke)
   05167 Kaposi sarcoma-associated herpesvirus infection
    56489 (Ikbke)
   05169 Epstein-Barr virus infection
    56489 (Ikbke)
   05165 Human papillomavirus infection
    56489 (Ikbke)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    56489 (Ikbke)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.10  IkappaB kinase
     56489 (Ikbke)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   56489 (Ikbke)
SSDB
Motif
Pfam: TBK1_CCD1 Pkinase TBK1_ULD PK_Tyr_Ser-Thr Pkinase_fungal Kinase-like APH zf-RING_9
Other DBs
NCBI-GeneID: 56489
NCBI-ProteinID: NP_062751
MGI: 1929612
Ensembl: ENSMUSG00000042349
Vega: OTTMUSG00000034782
UniProt: Q9R0T8
LinkDB
Position
1; 1 E4
AA seq 717 aa
MQSTTNYLWHTDDLLGQGATASVYKARNKKSGEVVAVKVFNSASYRRPPEVQVREFEVLR
RLNHQNIVKLFAVEETGGSRQKVLIMEYCSSGSLLSVLEDPENTFGLSEEEFLVVLRCVV
AGMNHLRENGIVHRDIKPGNIMRLVGEEGQSIYKLSDFGAARKLDDDEKFVSVYGTEEYL
HPDMYERAVLRKPQQKAFGVTVDLWSIGVTLYHAATGSLPFIPFGGPRRNKEIMYRITTE
KPAGAISGTQKQENGPLEWSYSLPITCRLSMGLQNQLVPILANILEVEEDKCWGFDQFFA
ETSDILQRTVIHVFSLPQAVLHHVYIHAHNTIAIFLEAVYEQTNVTPKHQEYLFEGHPCV
LEPSLSAQHIAHTAASSPLTLFSMSSDTPKGLAFRDPALDVPKFVPKVDLQADYSTAKGV
LGAGYQALWLARVLLDGQALMLRGLHWVLEVLQDTCQQTLEVTRTALLYLSSSLGTERFS
SGAGMPDVQERKEATELRTRLQTLSEILSKCSHNVTETQRSLSCLGEELLKNRDQIHEDN
KSIQKIQCCLDKMHFIYKQFKKSRMRPGLSYNEEQIHKLDKVNFSHLAKRLLQVFQEECV
QTYQVSLVTHGKRMRQVQRAQNHLHLIGHSVATCNSEARGAQESLNKIFDQLLLDRASEQ
GAEVSPQPMAPHPGPDPKDLVFHMQELCNDMKLLAFDLQDNNRLIERLHRVPSAPDV
NT seq 2154 nt   +upstreamnt  +downstreamnt
atgcagagtaccactaactacctgtggcatactgatgacctgctagggcagggggccact
gccagtgtgtacaaggcccgaaacaagaaatccggggaggtggttgctgtaaaggtcttc
aactcagccagctatcggcgacctcctgaggttcaggtgagggagtttgaggtcctgcgg
aggctgaatcaccagaacatcgtgaagctattcgcagtggaggaaacgggaggcagccgg
cagaaggtgctaatcatggagtactgctccagtgggagcctgctgagcgtgctggaagac
cctgagaacacgttcgggctttctgaagaggagttcctagtggtgctgcgctgtgtggtg
gctggcatgaaccacctgcgggagaatggcattgtccatcgggacatcaaacctgggaac
atcatgcgcctggtgggcgaggaggggcagagcatctataagctgtctgacttcggggct
gcccgcaagctggacgatgatgagaagtttgtttctgtctatggtacagaggaatacctg
caccctgacatgtatgagcgtgcagtgctgcgcaaaccccagcaaaaggcatttggtgtg
actgtggatctctggagtattggggtgaccctgtaccacgcagccacaggcagtctgccc
ttcatccccttcggtgggccccggcgcaacaaagagatcatgtacagaatcaccacagag
aagccagccggggccatttcagggactcagaagcaggaaaatggtcccttggagtggagc
tacagcctccccatcacctgtagactgtccatgggactgcagaaccagctggtgcccatc
ctggccaacatcctggaggtggaagaggataagtgctggggctttgatcagttcttcgcg
gagaccagtgacattctgcagcgaacggtcatccacgtcttttccctaccccaggccgtt
ttgcatcatgtctacatccacgcccacaacacgattgccatctttttggaggctgtatat
gagcagaccaacgtgacccccaaacaccaggagtacctcttcgagggtcacccttgtgtc
cttgagccaagcctctcagcccagcacatcgcccacacagctgccagcagccctctaact
ctgttcagcatgtccagcgacacacctaaggggctggccttcagggaccctgctctggat
gtcccaaagttcgtccctaaggttgacctacaggccgattacagcacagctaagggggtg
ctgggcgctggctaccaggccctgtggctggcgcgggtcctgctggatggacaggcgttg
atgcttcgggggttacattgggtcctggaggtgcttcaggacacgtgccagcagacactg
gaggtcacacggacagccctcctctacctcagcagcagcctgggcactgaaaggttcagc
agtggagcggggatgcctgacgtccaggaacgaaaggaggccacagagctaagaaccagg
ctgcagactctctcagagatcctgtctaaatgttcccacaatgtcacagaaacccaaagg
agcctgagctgtctgggtgaagagcttttaaagaaccgggaccagattcatgaggataac
aaaagtatccagaagattcagtgttgtttggacaagatgcacttcatctacaaacagttc
aagaaatccaggatgaggccagggctcagctacaatgaggagcagatccacaagctggat
aaggtaaatttcagtcatctagccaagaggctgctgcaggtgttccaggaggagtgtgtg
cagacgtatcaggtgtcgctggtcacacacggcaagcggatgaggcaggtgcagagggcc
cagaaccacctgcatctcattggccactctgtggccacctgtaactcggaagcccgggga
gcccaggagagtctgaacaagatctttgatcagctccttctggacagagcttccgaacag
ggagctgaggtgtcaccgcaacctatggctcctcatcccggccctgatccgaaggacctg
gtcttccacatgcaggagctttgtaatgatatgaagctattggcctttgatctccaggac
aacaaccgactcatcgaacggttacatagagttccatcggcaccagatgtctga

DBGET integrated database retrieval system