KEGG   Mus musculus (mouse): 56532
Entry
56532             CDS       T01002                                 

Gene name
Ripk3, 2610528K09Rik, AW107945, R, Rip3
Definition
(RefSeq) receptor-interacting serine-threonine kinase 3
  KO
K08847  receptor-interacting serine/threonine-protein kinase 3 [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04217  Necroptosis
mmu04621  NOD-like receptor signaling pathway
mmu04623  Cytosolic DNA-sensing pathway
mmu04668  TNF signaling pathway
mmu05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    56532 (Ripk3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    56532 (Ripk3)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    56532 (Ripk3)
   04623 Cytosolic DNA-sensing pathway
    56532 (Ripk3)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    56532 (Ripk3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    56532 (Ripk3)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     56532 (Ripk3)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: TKL group
  RIPK family [OT]
   56532 (Ripk3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr RHIM APH Serglycin
Other DBs
NCBI-GeneID: 56532
NCBI-ProteinID: NP_064339
MGI: 2154952
Ensembl: ENSMUSG00000022221
UniProt: Q9QZL0
LinkDB
Structure
PDB: 
6OKO 4M66 4M69

Position
14; 14 C3
AA seq 486 aa
MSSVKLWPTGASAVPLVSREELKKLEFVGKGGFGVVFRAHHRTWNHDVAVKIVNSKKISW
EVKAMVNLRNENVLLLLGVTEDLQWDFVSGQALVTRFMENGSLAGLLQPECPRPWPLLCR
LLQEVVLGMCYLHSLNPPLLHRDLKPSNILLDPELHAKLADFGLSTFQGGSQSGSGSGSG
SRDSGGTLAYLDPELLFDVNLKASKASDVYSFGILVWAVLAGREAELVDKTSLIRETVCD
RQSRPPLTELPPGSPETPGLEKLKELMIHCWGSQSENRPSFQDCEPKTNEVYNLVKDKVD
AAVSEVKHYLSQHRSSGRNLSAREPSQRGTEMDCPRETMVSKMLDRLHLEEPSGPVPGKC
PERQAQDTSVGPATPARTSSDPVAGTPQIPHTLPFRGTTPGPVFTETPGPHPQRNQGDGR
HGTPWYPWTPPNPMTGPPALVFNNCSEVQIGNYNSLVAPPRTTASSSAKYDQAQFGRGRG
WQPFHK
NT seq 1461 nt   +upstreamnt  +downstreamnt
atgtcttctgtcaagttatggcctactggtgcgtcagcggttcctctggtgagccgtgaa
gaactgaagaagctggagtttgtgggtaaaggagggttcggagtcgtgttccgggcacac
cacagaacatggaaccatgatgtagcagtcaagatcgtgaactcgaagaagatatcctgg
gaggtgaaggctatggttaatcttcgtaatgagaacgttctgctcctgctgggggtcact
gaggacctccagtgggacttcgtgtccgggcaggctctggtgacaagattcatggagaat
ggctccctcgcagggctgctgcaacccgagtgccctcggccctggccactcctctgtcgc
ctgctgcaggaagtggtgctggggatgtgctacctacacagcttgaaccctccgctcctg
caccgggacctcaagccctctaacattctgctggatccagagctccacgccaagctagca
gattttggcctgtccacgtttcagggagggtcccagtcagggtcaggatcaggatcagga
tccagggactctgggggcaccctagcgtacttggacccagagctgttatttgatgtcaac
ctgaaggcttctaaagcgagtgatgtctacagctttgggatcctcgtgtgggcagtgctg
gctggcagagaagctgagttggtagacaagacttcactaatccgggaaacagtgtgtgac
aggcagagtcgtcctccactgacagagctgcctccaggtagccctgagactcccggcttg
gaaaaactgaaggagttaatgattcattgctggggttcccagtccgaaaacaggccatcc
ttccaggactgcgaaccaaaaaccaatgaagtttacaatctggtaaaggacaaggtagat
gctgctgtctccgaggtaaagcattatctgtctcagcacagaagcagcggcagaaacttg
tctgccagagagccaagccaaagaggcacagaaatggattgcccgagggaaaccatggtt
tctaaaatgctggaccgcctgcatttggaggaaccctccggaccagttcctggaaaatgt
cctgagaggcaagcacaggacacatcagttgggcctgccacaccagcaaggacatcttct
gaccccgtggctggcactcctcagattccacatactttacccttcagaggcacaacacct
gggccagtctttactgagactcccggtcctcacccccaaaggaatcagggagatggaaga
cacggcactccttggtatccctggaccccaccgaatccaatgacagggccaccggctctc
gtcttcaacaactgttctgaagtgcagattgggaactacaactccttggtagcaccacca
agaactactgcctcaagttcggccaagtatgaccaagcacagttcggcaggggtaggggc
tggcagcccttccacaagtag

DBGET integrated database retrieval system