KEGG   Mus musculus (mouse): 56636Help
Entry
56636             CDS       T01002                                 

Gene name
Fgf21
Definition
(RefSeq) fibroblast growth factor 21
  KO
K22429  fibroblast growth factor 21
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04714  Thermogenesis
mmu04810  Regulation of actin cytoskeleton
mmu05200  Pathways in cancer
mmu05218  Melanoma
mmu05224  Breast cancer
mmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    56636 (Fgf21)
   04015 Rap1 signaling pathway
    56636 (Fgf21)
   04010 MAPK signaling pathway
    56636 (Fgf21)
   04151 PI3K-Akt signaling pathway
    56636 (Fgf21)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    56636 (Fgf21)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    56636 (Fgf21)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    56636 (Fgf21)
  09162 Cancer: specific types
   05226 Gastric cancer
    56636 (Fgf21)
   05218 Melanoma
    56636 (Fgf21)
   05224 Breast cancer
    56636 (Fgf21)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   56636 (Fgf21)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   56636 (Fgf21)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FGF
Motif
Other DBs
NCBI-GeneID: 56636
NCBI-ProteinID: NP_064397
MGI: 1861377
Ensembl: ENSMUSG00000030827
Vega: OTTMUSG00000058294
UniProt: Q9JJN1
LinkDB All DBs
Position
7; 7 B3
AA seq 210 aa AA seqDB search
MEWMRSRVGTLGLWVRLLLAVFLLGVYQAYPIPDSSPLLQFGGQVRQRYLYTDDDQDTEA
HLEIREDGTVVGAAHRSPESLLELKALKPGVIQILGVKASRFLCQQPDGALYGSPHFDPE
ACSFRELLLEDGYNVYQSEAHGLPLRLPQKDSPNQDATSWGPVRFLPMPGLLHEPQDQAG
FLPPEPPDVGSSDPLSMVEPLQGRSPSYAS
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atggaatggatgagatctagagttgggaccctgggactgtgggtccgactgctgctggct
gtcttcctgctgggggtctaccaagcataccccatccctgactccagccccctcctccag
tttgggggtcaagtccggcagaggtacctctacacagatgacgaccaagacactgaagcc
cacctggagatcagggaggatggaacagtggtaggcgcagcacaccgcagtccagaaagt
ctcctggagctcaaagccttgaagccaggggtcattcaaatcctgggtgtcaaagcctct
aggtttctttgccaacagccagatggagctctctatggatcgcctcactttgatcctgag
gcctgcagcttcagagaactgctgctggaggacggttacaatgtgtaccagtctgaagcc
catggcctgcccctgcgtctgcctcagaaggactccccaaaccaggatgcaacatcctgg
ggacctgtgcgcttcctgcccatgccaggcctgctccacgagccccaagaccaagcagga
ttcctgcccccagagcccccagatgtgggctcctctgaccccctgagcatggtagagcct
ttacagggccgaagccccagctatgcgtcctga

DBGET integrated database retrieval system