KEGG   Mus musculus (mouse): 57320Help
Entry
57320             CDS       T01002                                 

Gene name
Park7, DJ-1, Dj1
Definition
(RefSeq) Parkinson disease (autosomal recessive, early onset) 7
  KO
K05687  protein DJ-1 [EC:3.5.1.124]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05012  Parkinson disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05012 Parkinson disease
    57320 (Park7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:mmu01002]
    57320 (Park7)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    57320 (Park7)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.124  protein deglycase
     57320 (Park7)
Peptidases [BR:mmu01002]
 Cysteine Peptidases
  Family C56: PfpI endopeptidase family
   57320 (Park7)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   57320 (Park7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DJ-1_PfpI ThiJ_like GATase_3
Motif
Other DBs
NCBI-GeneID: 57320
NCBI-ProteinID: NP_065594
MGI: 2135637
Ensembl: ENSMUSG00000028964
Vega: OTTMUSG00000010158
UniProt: Q99LX0
LinkDB All DBs
Position
4; 4 E2
AA seq 189 aa AA seqDB search
MASKRALVILAKGAEEMETVIPVDVMRRAGIKVTVAGLAGKDPVQCSRDVMICPDTSLED
AKTQGPYDVVVLPGGNLGAQNLSESPMVKEILKEQESRKGLIAAICAGPTALLAHEVGFG
CKVTTHPLAKDKMMNGSHYSYSESRVEKDGLILTSRGPGTSFEFALAIVEALVGKDMANQ
VKAPLVLKD
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggcttccaaaagagctctggtcatcctggccaaaggagcagaggagatggagacagtg
attcctgtggatgtcatgcggcgagccgggatcaaagtcactgttgcaggcttggctggg
aaggaccccgtgcagtgtagccgtgatgtaatgatttgtccagataccagtctggaagat
gcaaaaacgcagggaccatacgatgtggtggttcttccaggaggaaatctgggtgcacag
aatttatctgagtcgcctatggtgaaggagatcctcaaggagcaggagagcaggaagggc
ctcatagctgccatctgtgcaggtcctacggctctgttggctcacgaagtaggttttgga
tgcaaggtcacaacacacccactggctaaggacaaaatgatgaatggcagtcactacagc
tactcagagagccgcgtggagaaggacggcctgatcctcaccagccgcgggccggggacc
agctttgagtttgcactagccattgtggaggcactcgtggggaaagacatggccaaccaa
gtgaaggcaccgcttgttctcaaagactag

DBGET integrated database retrieval system