KEGG   Mus musculus (mouse): 57913Help
Entry
57913             CDS       T01002                                 

Gene name
Pidd1, 1200011D09Rik, AU042446, Lrdd, Pidd
Definition
(RefSeq) p53 induced death domain protein 1
  KO
K10130  leucine-rich repeats and death domain-containing protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04064  NF-kappa B signaling pathway
mmu04115  p53 signaling pathway
mmu04210  Apoptosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    57913 (Pidd1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    57913 (Pidd1)
   04115 p53 signaling pathway
    57913 (Pidd1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_S68 LRR_8 LRR_4 ZU5 Death
Motif
Other DBs
NCBI-GeneID: 57913
NCBI-ProteinID: NP_073145
MGI: 1889507
Ensembl: ENSMUSG00000025507
Vega: OTTMUSG00000024561
UniProt: Q9ERV7
LinkDB All DBs
Position
7; 7 F5
AA seq 915 aa AA seqDB search
MAAVLEGQEPEETAAAAEDAATSTLEAVDAGPGAPFLPAGNQLNLDLRPGGCHRLQYLCS
QQPPQLLQVEFLRLSTHEDPQLLDDTLAKVPWSLLRLRSLVLKGGQSRGALGACLHGTLT
TLPAGLSDLACLAHLDLSFNRLETLPTCVPELHGLDALLLSHNHLSELPEALGALPALTF
LTVTHNRLERLPLTLGSLSTLQRLDLSENLLDTIPSEIGNLRSLSELNLASNRLQSLPAS
LAGLRSLRLLVLHSNLLTSVPTGLVHLPLITRLDLRDNRLRDLPAELLDAPFVRLQGNPL
GEASPAPPSPPDISQVPEMPRLLLTSDLDSFLVTPHGCSVTLACGVRLQFPAGATTTPVT
IHYRLWLPEPGLVSLGPHDFLLSSVLELQPHGVAFQQDVSLWLLFVPPRVRRCREVVVRT
RSNNTWNDLETQLEEEAPKRLWARCQVPHFSWFLVVLRPVSNTCLLPPEGALLCSSGHPG
VRVTFPPGVTEEPRQVSMQVVHMAGLELRTLLEESEASVSPLLCLSQSGPPSFLQPVTVQ
LPLPPGVTGFSLDRSHLHLLYRTPLTTTWDDITTQVALEFTHLYARFQVTHFSWYWLWYT
TKTCVGGLARKAWERLRLHRVNLIALQRRRDPEQVLLQCLPRNKVDATLSRLLVRYRGPE
PSETVEMFEGEKFFAAFERGIDVDADRPDCVDGRICFVFYSHLKNVKEVYITTALDREAQ
DVRGQVSFYRGSLPVEVPAEAEAARQRKGTDALWMATLPIKLPRLRGAQGSGQGTDFSLM
PLNLGDAETGFLTQSNLLSVASRLGPDWPAVALHLGMPYHKLQRIRHEFRDDLDGQVRHM
LFSWAERQTGQPGAVGHLVQALEQSDRRDVAEEVRAILELGRHKYQDSIRRTGLAPEDST
LPGTSASQTPESAQA
NT seq 2748 nt NT seq  +upstreamnt  +downstreamnt
atggctgcagtgttggaggggcaggagccggaggaaactgcagctgctgcagaggatgct
gcaacatccaccttggaggctgtggatgccgggcctggagcaccttttctcccggctggg
aaccagttgaacttggacctacgcccagggggctgccatcggctacagtacctgtgttcc
cagcagcccccacagctgctgcaagtggagtttttgcggctcagcacccatgaggaccct
cagctgctggatgacaccctagccaaggttccgtggagtctgctgcgccttcgctccctg
gtcctcaaaggtggccagagccggggtgccctgggtgcctgcctccatggaaccctgacc
actctgcctgctggcctgagtgatttggcctgcctggctcacctagacctgagcttcaac
aggctggagacgctgcctacctgtgtcccggaactgcacggcctggatgcgttgctgctt
tctcacaaccatctctcagagctgcccgaggccctgggggcactgcccgcccttaccttc
ctcaccgtgacacacaaccgcctagaaagactacccctaacactcgggtccctgtccacc
cttcagcgtctcgatctctctgagaaccttctagacaccataccctctgagattggaaac
ctgcgcagcctcagtgagctcaatctggcctccaaccggctgcagagtctcccagcttcc
ctcgcggggctgcggtccctgcggctccttgttctgcacagcaacctcctgacctcagtg
cccactggcctggtccacctgccactgatcactcggcttgacctgagggacaaccggctc
cgagacctgcctgctgagttactagacgctccctttgtgcgcctgcaggggaaccctctg
ggcgaggcctctccagcacccccaagtcccccagacatatcccaggttccagaaatgccc
aggctattgctgacctcagatttggacagcttccttgtgactccccatggctgttctgtg
accctggcctgtggtgtccgcctacagtttccagcaggagccaccaccacgcctgtcacc
atccactatcgactctggttgcccgagccaggcctggtctctctgggacctcatgacttc
ctgcttagtagtgtcctggagctgcagccccatggggtggctttccagcaagatgtgagc
ttatggctgctctttgtccctccacgagtccgtcgctgtcgtgaggtagttgtgaggaca
cggagtaacaacacctggaatgacctagagacccaactggaggaagaggcacccaagagg
ctctgggctcgctgccaggtgccccacttctcctggttcctggtcgttttacgcccagta
tccaacacttgccttttgccaccagagggagcacttctctgctcctcaggtcatcctggg
gtcagagtcacttttccccctggggttacagaagagcctcggcaagtctccatgcaggta
gtgcatatggctggactagagctgagaacccttctggaagaatcagaggcatcagtaagc
cctctgctgtgcctttcacagagcggcccccccagcttcctacaacctgtcactgtgcag
ttgcccctgcctcctggcgttacaggcttcagtctagaccgctcccacctgcatctgctc
taccgaacacccctgacaaccacctgggatgatatcaccactcaggtggcactggaattc
acccacctgtatgcacgcttccaggtcacgcacttctcctggtactggctctggtatacc
accaaaacctgtgtggggggcctggcccggaaggcctgggaacggctgcgactgcaccgt
gtgaatctcattgcactgcagaggcgccgagaccctgagcaggttctgctgcagtgcctg
ccacggaacaaggtagatgccaccctgagtcggctgctggttcgctaccgtggccctgaa
ccctctgagactgtggagatgtttgagggtgagaagttctttgcagcctttgagcggggc
attgatgtagatgcagaccgtccagactgtgtggatggcagaatctgctttgtcttctat
tcacacctgaagaacgtaaaggaggtatacatcaccacagccttggaccgggaagctcag
gatgttcgaggacaggtgtccttttatcggggttcacttcctgtggaggtacctgcagag
gcagaggctgcccggcagaggaagggtacagatgcactgtggatggccaccttgcccatc
aagctaccgagactccggggtgcccaggggagtgggcaggggactgacttctccttgatg
cctctgaacctgggtgatgcagaaactggattcctgactcagagcaacctgctgagtgtg
gcctcacgcctaggtcctgactggccagctgtggccctgcacctaggcatgccctaccat
aagctacagcgtatccggcatgaattcagggatgacctggatggccaggtccgacacatg
ctcttctcttgggctgagcgccagactggacagcctggagctgtgggacacctggtacag
gccttggaacagagtgatcggcgggatgtggctgaagaggtgcgtgccatcttggagctt
ggccgccacaagtaccaggacagcattcgacgcacagggctggcccctgaggattctact
ctgcctggcacctcggcttcacagactccagagtctgcacaggcctag

DBGET integrated database retrieval system