KEGG   Mus musculus (mouse): 58231Help
Entry
58231             CDS       T01002                                 

Gene name
Stk4, AI447339, AU020804, Kas-2, Mst1, Ysk3
Definition
(RefSeq) serine/threonine kinase 4
  KO
K04411  serine/threonine kinase 4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04068  FoxO signaling pathway
mmu05200  Pathways in cancer
mmu05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    58231 (Stk4)
   04010 MAPK signaling pathway
    58231 (Stk4)
   04068 FoxO signaling pathway
    58231 (Stk4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    58231 (Stk4)
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    58231 (Stk4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    58231 (Stk4)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: STE group
  STE20 family
   58231 (Stk4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Mst1_SARAH Pkinase_fungal Haspin_kinase Abi_2 DUF4611 Hamartin
Motif
Other DBs
NCBI-GeneID: 58231
NCBI-ProteinID: NP_067395
MGI: 1929004
Ensembl: ENSMUSG00000018209
Vega: OTTMUSG00000001179
UniProt: Q9JI11
LinkDB All DBs
Position
2; 2 H3
AA seq 487 aa AA seqDB search
METVQLRNPPRRQLKKLDEDSLTKQPEEVFDVLEKLGEGSYGSVYKAIHKETGQIVAIKQ
VPVESDLQEIIKEISIMQQCDSPHVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKT
LTEDEIATILQSTLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAK
RNTVIGTPFWMAPEVIQEIGYNCVADIWSLGITAIEMAEGKPPYADIHPMRAIFMIPTNP
PPTFRKPELWSDNFMDFVKQCLVKSPEQRATATQLLQHPFVKSAKGVSILRDLINEAMDV
KLKRQEAQQREVDQDDEENSEEDEMDSGTMVRAAGDEMGTVRVASTMSGGANTMIEHGDT
LPSQLGTMVINTEDEEEEGTMKRRDETMQPAKPSFLEYFEQKEKENQINSFGKNVSGSLK
NSSDWKIPQDGDYEFLKSWTVEDLQKRLLALDPMMEQEMEEIRQKYRSKRQPILDAIEAK
KRRQQNF
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atggagaccgtgcagctgaggaacccaccgcgcaggcagctgaaaaagttggatgaagat
agtttaaccaagcagcccgaggaagtgtttgatgtcttagagaagcttggagaggggtct
tatggcagcgtgtacaaggctattcataaagagactggccagattgttgcaatcaagcaa
gtgcccgtggaatcggacctgcaggagataatcaaggaaatctccatcatgcagcagtgt
gacagccctcacgtagtcaagtattatggcagctactttaagaacacagacctgtggatt
gttatggagtactgtggggctggttctgtatctgatatcattcggctacggaacaagacg
ttaacagaagatgaaatagctacaatattacaatcaactcttaagggactagaatacctt
cattttatgagaaaaatacaccgagatatcaaggcgggaaatattttgctaaacacagaa
ggccatgcaaagcttgcagactttggagtcgcaggtcaacttacagataccatggcaaag
aggaatacagtaatagggaccccgttttggatggctcctgaagttattcaggaaattggg
tacaactgtgtggcagacatctggtctctgggaataactgccatagaaatggctgaagga
aagcccccatatgctgatatccatccaatgagggcaatattcatgattcctacaaaccct
cctcccacattccgtaagccagagctgtggtcagacaacttcatggattttgtgaagcag
tgtctggtaaaaagcccggagcagagagccacagccactcagctcctacagcacccgttt
gttaagagtgccaaaggagtgtcaatattgcgagacttaattaacgaagccatggatgtg
aaactgaagcgccaggaagcccagcagcgggaagtggaccaggacgacgaggagaactca
gaggaggatgaaatggattccggcacgatggttcgagctgccggtgatgagatgggcact
gtccgagtagccagcacgatgagcggaggagccaatactatgattgagcacggtgacacg
ttgccgtcccagctgggcaccatggtgatcaacacggaggacgaggaagaggaaggaacc
atgaaaagaagagatgagaccatgcagcctgcaaaaccgtctttccttgaatactttgaa
caaaaagaaaaggaaaatcagatcaacagctttggcaagaatgtatctggctctctgaag
aattcttccgattggaaaatccctcaggatggagactatgagtttctcaagagctggact
gtggaggaccttcagaagaggctcttggccctcgaccccatgatggaacaggaaatggaa
gagatccggcagaagtaccggtccaagcggcagccaatcctggatgccattgaagccaag
aagaggaggcaacagaacttctga

DBGET integrated database retrieval system