KEGG   Mus musculus (mouse): 58801Help
Entry
58801             CDS       T01002                                 

Gene name
Pmaip1, Noxa
Definition
(RefSeq) phorbol-12-myristate-13-acetate-induced protein 1
  KO
K10131  phorbol-12-myristate-13-acetate-induced protein 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01524  Platinum drug resistance
mmu04115  p53 signaling pathway
mmu04210  Apoptosis
mmu04215  Apoptosis - multiple species
mmu05200  Pathways in cancer
mmu05203  Viral carcinogenesis
mmu05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    58801 (Pmaip1)
   04215 Apoptosis - multiple species
    58801 (Pmaip1)
   04115 p53 signaling pathway
    58801 (Pmaip1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    58801 (Pmaip1)
   05203 Viral carcinogenesis
    58801 (Pmaip1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    58801 (Pmaip1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    58801 (Pmaip1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMAIP1
Motif
Other DBs
NCBI-GeneID: 58801
NCBI-ProteinID: NP_067426
MGI: 1930146
Ensembl: ENSMUSG00000024521
UniProt: Q9JM54
LinkDB All DBs
Structure
PDB: 

Position
18; 18 E1
AA seq 103 aa AA seqDB search
MPGRKARRNAPVNPTRAELPPEFAAQLRKIGDKVYCTWSAPDITVVLAQMPGKSQKSRMR
SPSPTRVPADLKDECAQLRRIGDKVNLRQKLLNLISKLFNLVT
NT seq 312 nt NT seq  +upstreamnt  +downstreamnt
atgcccgggagaaaggcgcgtcggaacgcgccagtgaacccaacgcgggcagagctacca
cctgagttcgcagctcaactcaggaagatcggagacaaagtgtattgcacgtggagtgca
ccggacataactgtggttctggcgcagatgcctgggaagtcgcaaaagagcaggatgagg
agcccaagcccaacccgggtgccagcagacttgaaggacgagtgtgctcaactccggagg
attggagacaaagtgaatttacggcagaaacttctgaatttgatttccaagctcttcaat
ttagtaacctga

DBGET integrated database retrieval system