KEGG   Mus musculus (mouse): 58988Help
Entry
58988             CDS       T01002                                 

Gene name
Rps6kb2, S6K-beta-2, S6K2
Definition
(RefSeq) ribosomal protein S6 kinase, polypeptide 2
  KO
K04688  ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu01522  Endocrine resistance
mmu04012  ErbB signaling pathway
mmu04066  HIF-1 signaling pathway
mmu04140  Autophagy - animal
mmu04150  mTOR signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04152  AMPK signaling pathway
mmu04211  Longevity regulating pathway
mmu04213  Longevity regulating pathway - multiple species
mmu04350  TGF-beta signaling pathway
mmu04371  Apelin signaling pathway
mmu04666  Fc gamma R-mediated phagocytosis
mmu04714  Thermogenesis
mmu04910  Insulin signaling pathway
mmu04931  Insulin resistance
mmu05163  Human cytomegalovirus infection
mmu05165  Human papillomavirus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05200  Pathways in cancer
mmu05205  Proteoglycans in cancer
mmu05210  Colorectal cancer
mmu05212  Pancreatic cancer
mmu05221  Acute myeloid leukemia
mmu05224  Breast cancer
mmu05225  Hepatocellular carcinoma
mmu05226  Gastric cancer
mmu05231  Choline metabolism in cancer
mmu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    58988 (Rps6kb2)
   04350 TGF-beta signaling pathway
    58988 (Rps6kb2)
   04371 Apelin signaling pathway
    58988 (Rps6kb2)
   04066 HIF-1 signaling pathway
    58988 (Rps6kb2)
   04151 PI3K-Akt signaling pathway
    58988 (Rps6kb2)
   04152 AMPK signaling pathway
    58988 (Rps6kb2)
   04150 mTOR signaling pathway
    58988 (Rps6kb2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    58988 (Rps6kb2)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    58988 (Rps6kb2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    58988 (Rps6kb2)
  09149 Aging
   04211 Longevity regulating pathway
    58988 (Rps6kb2)
   04213 Longevity regulating pathway - multiple species
    58988 (Rps6kb2)
  09159 Environmental adaptation
   04714 Thermogenesis
    58988 (Rps6kb2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    58988 (Rps6kb2)
   05205 Proteoglycans in cancer
    58988 (Rps6kb2)
   05231 Choline metabolism in cancer
    58988 (Rps6kb2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    58988 (Rps6kb2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    58988 (Rps6kb2)
   05212 Pancreatic cancer
    58988 (Rps6kb2)
   05225 Hepatocellular carcinoma
    58988 (Rps6kb2)
   05226 Gastric cancer
    58988 (Rps6kb2)
   05221 Acute myeloid leukemia
    58988 (Rps6kb2)
   05224 Breast cancer
    58988 (Rps6kb2)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    58988 (Rps6kb2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    58988 (Rps6kb2)
   05163 Human cytomegalovirus infection
    58988 (Rps6kb2)
   05165 Human papillomavirus infection
    58988 (Rps6kb2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    58988 (Rps6kb2)
   01522 Endocrine resistance
    58988 (Rps6kb2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    58988 (Rps6kb2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     58988 (Rps6kb2)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   58988 (Rps6kb2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_C Kinase-like Pkinase_fungal Kdo Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 58988
NCBI-ProteinID: NP_067460
MGI: 1927343
Ensembl: ENSMUSG00000024830
Vega: OTTMUSG00000028311
UniProt: Q9Z1M4
LinkDB All DBs
Position
19; 19 A
AA seq 485 aa AA seqDB search
MAAVFDLDLETEEGSEGEGEPEFSPADVCPLGELRAAGLETVGHYEEVELTESSVNLGPE
RIGPHCFELLSVLGKGGYGKVFQVRKVQGTNLGKIYAMKVLRKAKIVCSAKDTAHTRAER
NILESVKHPFIVELAYAFQTGGKLYLILECLSGGELFTHLEREGIFLEDTACFYLAEITL
ALGHLHSHGIIYRDLKPENIMLSSQGHIKLTDFGLCKESIHEGAITHTFCGTIEYMAPEI
LVRTGHNRAVDWWSLGALMYDMLTGSPPFTAENRKKTMDKIIKGKLVLPPYLTPDARDLA
KKFLKRNPTQRIGGGLGDAADVQRHPFFRHINWDDLLARRVDPPFRPSLQSEEDVSQFDA
RFTRQTPVDSPDDTALSESANQAFLGFTYVAPSVLDSIKEGFSFQPKLRSPRRLNSSPRT
PISPLKFSPFEGFRPSPGPPEPMEPSLPPLLPSPPSPPPTSTAPLPIRPPSGTKKSKKGR
GRSGR
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atggcggccgtatttgatttagacttggagaccgaggaagggagcgagggcgagggcgaa
ccggagttcagccctgcggacgtgtgtccccttggcgaattaagggctgctggcctggag
acagtgggacactatgaagaagtagagctgacagagagcagcgtgaacctgggtcctgag
cgcatcgggccccactgctttgagctactgagtgtactgggcaaggggggctatggcaag
gtgttccaggtgagaaaagtgcaaggcaccaacttgggaaaaatatatgccatgaaggtc
ttaaggaaggccaagattgtatgcagtgccaaggacacagcccatacccgggctgagagg
aacattctagaatctgtgaagcatcccttcattgtagaactggcctatgctttccagaca
ggtggcaaactctacctcatcctggagtgcctcagtggtggtgagctcttcacacatctt
gagcgagaaggcatcttcctggaagacacagcctgcttctacctggcagagatcacacta
gccctgggccatctccattcccacggcatcatctaccgggacctcaagcctgagaacatc
atgctcagcagccagggccacatcaaactgacagactttggactttgcaaggagtccatt
catgagggtgctatcactcacaccttctgtggcaccattgagtacatggccccagagatt
ctagtgcgcactggtcacaaccgggcagtggactggtggagcctgggagccctgatgtac
gacatgctcactggatcgccgcccttcactgcagagaaccggaagaaaactatggataaa
atcattaaagggaagctggtgctgcccccctacctcaccccggatgcccgggaccttgcc
aaaaagtttctgaagcggaaccccactcagcgaattgggggtggcctgggagatgctgct
gatgtccagaggcacccctttttccggcacatcaattgggatgatctcttggcccgccgc
gtggaccctcccttcaggccaagtctgcaatcagaagaggatgtgagccagtttgatgca
cgattcacacggcagacgccggtagatagtccagatgacacagccctcagtgagagtgcc
aaccaagccttcctgggctttacatatgtggcaccttctgtcctggacagcatcaaagag
ggcttctccttccagcccaagctgcgttctcccagacgccttaacagcagtccccgcacc
cccatcagccccctcaagttctctccctttgaggggttccggcccagtcccggcccacca
gagcccatggagccatctctacctccactcctaccatcaccaccatcaccaccacccaca
agcactgccccccttcccatccgtcctccctcaggaaccaagaagtccaagaagggacgg
ggccgctcagggcgttag

KEGG   Mus musculus (mouse): 72508Help
Entry
72508             CDS       T01002                                 

Gene name
Rps6kb1, 2610318I15Rik, AA959758, AI256796, AI314060, P70S6K1, S6K, S6K-beta-1, S6K1, p70_S6K-alpha, p70_S6KA, p70-S6K_1, p70/85s6k, p70s6k
Definition
(RefSeq) ribosomal protein S6 kinase, polypeptide 1
  KO
K04688  ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu01522  Endocrine resistance
mmu04012  ErbB signaling pathway
mmu04066  HIF-1 signaling pathway
mmu04140  Autophagy - animal
mmu04150  mTOR signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04152  AMPK signaling pathway
mmu04211  Longevity regulating pathway
mmu04213  Longevity regulating pathway - multiple species
mmu04350  TGF-beta signaling pathway
mmu04371  Apelin signaling pathway
mmu04666  Fc gamma R-mediated phagocytosis
mmu04714  Thermogenesis
mmu04910  Insulin signaling pathway
mmu04931  Insulin resistance
mmu05163  Human cytomegalovirus infection
mmu05165  Human papillomavirus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05200  Pathways in cancer
mmu05205  Proteoglycans in cancer
mmu05210  Colorectal cancer
mmu05212  Pancreatic cancer
mmu05221  Acute myeloid leukemia
mmu05224  Breast cancer
mmu05225  Hepatocellular carcinoma
mmu05226  Gastric cancer
mmu05231  Choline metabolism in cancer
mmu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    72508 (Rps6kb1)
   04350 TGF-beta signaling pathway
    72508 (Rps6kb1)
   04371 Apelin signaling pathway
    72508 (Rps6kb1)
   04066 HIF-1 signaling pathway
    72508 (Rps6kb1)
   04151 PI3K-Akt signaling pathway
    72508 (Rps6kb1)
   04152 AMPK signaling pathway
    72508 (Rps6kb1)
   04150 mTOR signaling pathway
    72508 (Rps6kb1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    72508 (Rps6kb1)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    72508 (Rps6kb1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    72508 (Rps6kb1)
  09149 Aging
   04211 Longevity regulating pathway
    72508 (Rps6kb1)
   04213 Longevity regulating pathway - multiple species
    72508 (Rps6kb1)
  09159 Environmental adaptation
   04714 Thermogenesis
    72508 (Rps6kb1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    72508 (Rps6kb1)
   05205 Proteoglycans in cancer
    72508 (Rps6kb1)
   05231 Choline metabolism in cancer
    72508 (Rps6kb1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    72508 (Rps6kb1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    72508 (Rps6kb1)
   05212 Pancreatic cancer
    72508 (Rps6kb1)
   05225 Hepatocellular carcinoma
    72508 (Rps6kb1)
   05226 Gastric cancer
    72508 (Rps6kb1)
   05221 Acute myeloid leukemia
    72508 (Rps6kb1)
   05224 Breast cancer
    72508 (Rps6kb1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    72508 (Rps6kb1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    72508 (Rps6kb1)
   05163 Human cytomegalovirus infection
    72508 (Rps6kb1)
   05165 Human papillomavirus infection
    72508 (Rps6kb1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    72508 (Rps6kb1)
   01522 Endocrine resistance
    72508 (Rps6kb1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    72508 (Rps6kb1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     72508 (Rps6kb1)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   72508 (Rps6kb1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_C Kinase-like Pkinase_fungal APH Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 72508
NCBI-ProteinID: NP_001107806
MGI: 1270849
Ensembl: ENSMUSG00000020516
Vega: OTTMUSG00000001198
UniProt: Q8BSK8 Q3UXD8
LinkDB All DBs
Position
11; 11 C
AA seq 525 aa AA seqDB search
MRRRRRRDGFYLAPDFRHREAEDMAGVFDIDLDQPEDAGSEDELEEGGQLNESMDHGGVG
PYELGMEHCEKFEISETSVNRGPEKIRPECFELLRVLGKGGYGKVFQVRKVTGANTGKIF
AMKVLKKAMIVRNAKDTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGEL
FMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLC
KESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKK
TIDKILKCKLNLPPYLTQEARDLLKKLLKRNAASRLGAGPGDAGEVQAHPFFRHINWEEL
LARKVEPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDSTLSESANQVFLGFTYVAPSVLE
SVKEKFSFEPKIRSPRRFIGSPRTPVSPVKFSPGDFWGRGASASTANPQTPVEYPMETSG
IEQMDVTVSGEASAPLPIRQPNSGPYKKQAFPMISKRPEHLRMNL
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgaggcgacgacggaggcgggacggcttttacctagcgcctgacttccgacacagggaa
gctgaggacatggcaggagtgtttgacatagacctggaccagccagaagatgcaggctct
gaggatgagctggaggaggggggtcagttaaatgaaagcatggaccatgggggagttgga
ccatatgaacttggcatggaacattgtgagaaatttgaaatctcagaaactagtgtgaac
agagggccagaaaaaatcagaccagaatgttttgagctacttcgggtacttggtaaaggg
ggctatggaaaggtttttcaagtacgaaaagtaacaggagcaaatactgggaagatattt
gccatgaaggtgcttaaaaaggcaatgatagtgaggaatgctaaggacacggcccacacg
aaagcagagcggaacattctggaggaagtgaaacaccctttcattgtggacctgatttat
gcctttcagaccggaggaaagctctacctcatcctcgagtatctcagtggaggagaacta
tttatgcagttagaaagagagggaatattcatggaagacacagcgtgcttttacttggct
gaaatctccatggctttggggcatttacatcaaaaagggatcatctacagagacctgaag
ccggagaacatcatgcttaatcaccaaggtcacgtgaaactaacagactttggactatgc
aaagaatctattcatgatggaacagtcacgcacacattttgtggaacaatagaatacatg
gcccctgaaatcttaatgagaagcggccacaaccgtgctgtggattggtggagtttggga
gcattaatgtatgacatgctgactggagcacctccattcactggggagaatagaaagaaa
acaattgacaaaatcctcaaatgtaaacttaatttgcctccctacctcacacaagaagct
cgagatctgcttaaaaagctgctgaaaagaaatgctgcttctcgtcttggagctggccct
ggggatgctggagaagtccaagctcatccttttttcagacacattaactgggaagaactt
ctggctcggaaggtggaacctccctttaagcctctgttgcaatctgaagaggatgtgagt
cagtttgattcaaagtttacacgtcagacacctgttgacagccctgatgactccactctc
agtgaaagtgccaaccaggtctttctgggttttacatatgtggctccatctgtacttgaa
agtgtgaaagaaaagttttcatttgaaccaaaaatccgatctcctagaagatttattggt
agtccacgaacacctgtcagcccagtcaaattctctcctggggatttctggggacgaggt
gcttcagccagcacggcaaatcctcagacccctgtggaatacccaatggaaacaagtggg
atagagcagatggatgtgacagtgagcggggaagcatcagcgccacttccaatccgacaa
cccaactccgggccgtacaaaaaacaagcttttcctatgatctccaaacggccagagcac
ctgcggatgaatctatga

DBGET integrated database retrieval system