KEGG   Mus musculus (mouse): 59004Help
Entry
59004             CDS       T01002                                 

Gene name
Pias4, PIASY, Pias-gamma, Piasg
Definition
(RefSeq) protein inhibitor of activated STAT 4
  KO
K16065  E3 SUMO-protein ligase PIAS4 [EC:2.3.2.27]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04064  NF-kappa B signaling pathway
mmu04120  Ubiquitin mediated proteolysis
mmu04630  Jak-STAT signaling pathway
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    59004 (Pias4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    59004 (Pias4)
   04064 NF-kappa B signaling pathway
    59004 (Pias4)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    59004 (Pias4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    59004 (Pias4)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     59004 (Pias4)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   59004 (Pias4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PINIT zf-MIZ zf-Nse SAP DARPP-32 Sporozoite_P67 CENP-B_dimeris
Motif
Other DBs
NCBI-GeneID: 59004
NCBI-ProteinID: NP_067476
MGI: 2136940
Ensembl: ENSMUSG00000004934
Vega: OTTMUSG00000030312
UniProt: Q9JM05 Q3ULQ6
LinkDB All DBs
Position
10; 10 C1
AA seq 507 aa AA seqDB search
MAAELVEAKNMVMSFRVSDLQMLLGFVGRSKSGLKHELVTRALQLVQFDCSPELFKKIKE
LYETRYAKKSAEPGPQAPRPLDPLALHSMPRTPLSGPTVDYPVLYGKYLNGLGRLPTKTL
KPEVRLVKLPFFNMLDELLKPTELVPQSAEKLQESPCIFALTPRQVEMIRNSRELQPGVK
AVQVVLRICYSDTSCPQEDQYPPNIAVKVNHSYCSVPGYYPSNKPGVEPKRPCRPINLTH
LMYLSSATNRITVTWGNYGKSYSVALYLVRQLTSSDLLQRLKTIGVKHPELCKALVKEKL
RLDPDSEIATTGVRVSLICPLVKMRLSVPCRAETCAHLQCFDAVFYLQMNEKKPTWMCPV
CDKPAAYDQLIIDGLLSKILSECEGADEIEFLAEGSWRPIRAEKEPSCSPQGPILVLGTS
DANGLAPASSTPGIGSGLSGPGSAGSGAGAAGSLENGKTGADVVDLTLDSSSSSEDEDED
EDDDEDEDEGPRPKRRCPFQKGLVPAC
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atggcggcagagctggtggaggccaaaaacatggtgatgagcttccgagtatcagacctg
cagatgctgctgggctttgtaggccggagcaagagtgggctgaagcacgaactggtgacc
agggccttgcagctggtgcagttcgactgtagcccagagcttttcaagaagatcaaagag
ctgtatgagactcgctatgccaagaagagtgcagagcccggcccacaggcaccacggccc
ctggatcccctggcactacactccatgcccaggactcccctgtcagggcccaccgtggac
taccccgtgctgtacgggaagtacttgaatggactggggcgcctgcccaccaagaccctt
aagccggaggtacgcctggttaagctccccttcttcaacatgctggacgaattgctgaag
cccactgaactggtcccacagagtgcagagaagctgcaagagagcccatgcatcttcgcg
ctaacacctcggcaggtggagatgatccgcaactccagggagctgcagcctggagtgaaa
gctgtgcaggtggtgctgaggatctgttactctgataccagctgtccgcaggaggaccaa
tacccacccaacatcgctgtgaaggtcaaccacagctactgctcagtgccgggctactat
ccctccaacaagcctggtgtggaacctaagaggccctgccgccccatcaaccttacccac
ctcatgtatctgtcctcggccaccaaccgcattactgtcacctggggcaactatggcaag
agctactctgtggctttgtacctggtgcgacagctgacctcctcagacctgctacagagg
ttgaagacgattggggtgaagcatcctgagctgtgcaaggctttggtcaaggagaagctt
cgcctagaccccgacagcgagatcgccactaccggagtgcgagtgtccctcatctgccca
ctggtgaagatgcgcctctcggtgccctgccgtgcagagacctgcgcacacctgcagtgc
tttgatgctgtgttctacctgcaaatgaatgagaagaagcccacctggatgtgccctgtg
tgtgacaagcctgcagcctatgaccagctcatcatagatgggctgctgtcgaagatcctg
agtgagtgtgagggcgcggatgagattgagttcctggcggaaggctcatggcgtccaatc
cgtgcagagaaggagccaagctgcagcccacagggccccatcctggtgctaggcacctcg
gacgccaatgggctcgcaccagcctccagcacccccggtataggcagtggcctgagtggc
ccaggcagcgccggcagcggtgcgggggcagcaggcagcctggagaatggcaagacggga
gccgacgtggtggacctcacactggacagctcgtcgtcctcggaagatgaagatgaggac
gaggacgacgatgaggacgaggacgagggcccccggccgaagcgccgctgcccgttccag
aaaggcctggtgcccgcgtgctga

DBGET integrated database retrieval system