KEGG   Mus musculus (mouse): 641025Help
Entry
641025            CDS       T01002                                 

Gene name
CRP55H, IGHV, IgVH, Igh, Igm
Definition
(RefSeq) Ig heavy chain Mem5-like
  KO
K06856  immunoglobulin heavy chain
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04020  Calcium signaling pathway
mmu04064  NF-kappa B signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04145  Phagosome
mmu04151  PI3K-Akt signaling pathway
mmu04640  Hematopoietic cell lineage
mmu04650  Natural killer cell mediated cytotoxicity
mmu04662  B cell receptor signaling pathway
mmu04664  Fc epsilon RI signaling pathway
mmu04666  Fc gamma R-mediated phagocytosis
mmu04672  Intestinal immune network for IgA production
mmu05140  Leishmaniasis
mmu05143  African trypanosomiasis
mmu05146  Amoebiasis
mmu05150  Staphylococcus aureus infection
mmu05152  Tuberculosis
mmu05169  Epstein-Barr virus infection
mmu05202  Transcriptional misregulation in cancer
mmu05310  Asthma
mmu05320  Autoimmune thyroid disease
mmu05322  Systemic lupus erythematosus
mmu05323  Rheumatoid arthritis
mmu05330  Allograft rejection
mmu05340  Primary immunodeficiency
mmu05414  Dilated cardiomyopathy (DCM)
mmu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    641025 (CRP55H)
   04020 Calcium signaling pathway
    641025 (CRP55H)
   04072 Phospholipase D signaling pathway
    641025 (CRP55H)
   04151 PI3K-Akt signaling pathway
    641025 (CRP55H)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    641025 (CRP55H)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    641025 (CRP55H)
   04650 Natural killer cell mediated cytotoxicity
    641025 (CRP55H)
   04662 B cell receptor signaling pathway
    641025 (CRP55H)
   04664 Fc epsilon RI signaling pathway
    641025 (CRP55H)
   04666 Fc gamma R-mediated phagocytosis
    641025 (CRP55H)
   04672 Intestinal immune network for IgA production
    641025 (CRP55H)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    641025 (CRP55H)
  09163 Immune disease
   05310 Asthma
    641025 (CRP55H)
   05322 Systemic lupus erythematosus
    641025 (CRP55H)
   05323 Rheumatoid arthritis
    641025 (CRP55H)
   05320 Autoimmune thyroid disease
    641025 (CRP55H)
   05330 Allograft rejection
    641025 (CRP55H)
   05340 Primary immunodeficiency
    641025 (CRP55H)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    641025 (CRP55H)
   05416 Viral myocarditis
    641025 (CRP55H)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    641025 (CRP55H)
   05152 Tuberculosis
    641025 (CRP55H)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    641025 (CRP55H)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    641025 (CRP55H)
   05140 Leishmaniasis
    641025 (CRP55H)
   05143 African trypanosomiasis
    641025 (CRP55H)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    641025 (CRP55H)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Phagocytosis
   Opsonins
    641025 (CRP55H)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: V-set Ig_3 ig I-set
Motif
Other DBs
NCBI-GeneID: 641025
NCBI-ProteinID: XP_017174429
LinkDB All DBs
Structure
PDB: 

Position
12
AA seq 245 aa AA seqDB search
MMVLSLLYLLTALPGILSEVQLQESGPSLVKPSQTLSLTCSVTGDSITSGYWNWIRKFPG
NKLEYMGYISYSGSTYYNPSLKSRISITRDTSKNQYYLQLNSVTTEDTATYYCARYTVWS
LQCVQCQVQLVETGGGLVRPGNSLKLSCVTSGFTFSNYRMHWLRQPPGKRLEWIAVITVK
SDNYGANYAESVKGRFTISRDDSKSSVYLQMNRLREEDTATYYCSRHTVGPSMRTHTQTS
LQVRS
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgatggtgttaagtcttctgtacctgttgacagcccttccgggtatcctgtcagaggtg
cagcttcaggagtcaggacctagcctcgtgaaaccttctcagactctgtccctcacctgt
tctgtcactggcgactccatcaccagtggttactggaactggatccggaaattcccaggg
aataaacttgagtacatggggtacataagctacagtggtagcacttactacaatccatct
ctcaaaagtcgaatctccatcactcgagacacatccaagaaccagtactacctgcagttg
aattctgtgactactgaggacacagccacatattactgtgcaagatacacagtgtggagt
cttcagtgtgtccagtgtcaggtgcagcttgtagagaccgggggaggcttggtgaggcct
ggaaattctctgaaactctcctgtgttacctcgggattcactttcagtaactaccggatg
cactggcttcgccagcctccagggaagaggctggagtggattgctgtaattacagtcaaa
tctgataattatggagcaaattatgcagagtctgtgaaaggcagattcactatttcaaga
gatgattcaaaaagcagtgtctacctgcagatgaacagattaagagaggaagacactgcc
acttattattgtagtagacacactgtggggccatcaatgagaacccatacacaaacctct
ctgcaggttcgttcatga

DBGET integrated database retrieval system