KEGG   Mus musculus (mouse): 64138Help
Entry
64138             CDS       T01002                                 

Gene name
Ctsz, AI787083, AU019819, CTSX, D2Wsu143e
Definition
(RefSeq) cathepsin Z
  KO
K08568  cathepsin X [EC:3.4.18.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04142  Lysosome
mmu04210  Apoptosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    64138 (Ctsz)
  09143 Cell growth and death
   04210 Apoptosis
    64138 (Ctsz)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    64138 (Ctsz)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.18  Cysteine-type carboxypeptidases
    3.4.18.1  cathepsin X
     64138 (Ctsz)
Peptidases and inhibitors [BR:mmu01002]
 Cysteine peptidases
  Family C1: papain family
   64138 (Ctsz)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C1 Peptidase_C1_2
Motif
Other DBs
NCBI-GeneID: 64138
NCBI-ProteinID: NP_071720
MGI: 1891190
Ensembl: ENSMUSG00000016256
Vega: OTTMUSG00000016461
UniProt: Q9WUU7 Q545I6
LinkDB All DBs
Position
2 H4; 2 97.94 cM
AA seq 306 aa AA seqDB search
MASSGSVQQLPLVLLMLLLASAARARLYFRSGQTCYHPIRGDQLALLGRRTYPRPHEYLS
PADLPKNWDWRNVNGVNYASVTRNQHIPQYCGSCWAHGSTSAMADRINIKRKGAWPSILL
SVQNVIDCGNAGSCEGGNDLPVWEYAHKHGIPDETCNNYQAKDQDCDKFNQCGTCTEFKE
CHTIQNYTLWRVGDYGSLSGREKMMAEIYANGPISCGIMATEMMSNYTGGIYAEHQDQAV
INHIISVAGWGVSNDGIEYWIVRNSWGEPWGEKGWMRIVTSTYKGGTGDSYNLAIESACT
FGDPIV
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgtcggggtcggtgcagcagctgcccctggtgctgctgatgttgctgttggcg
agtgcggcacgggccagactctacttccgctcgggccagacttgctaccatcccattcgc
ggggaccagctggctctgctggggcgcaggacttatcctcggccgcatgagtacctgtcc
ccagcggatctccccaagaattgggactggagaaatgtgaacggtgtcaactatgccagc
gtcaccaggaaccagcacatcccacagtactgtggttcctgctgggcccacggcagcacc
agtgccatggcagaccgaatcaacatcaagaggaaaggtgcatggccctccatcctgctg
tccgtacagaatgtcattgactgtggcaatgctggctcttgtgaagggggcaatgacctt
ccggtgtgggagtatgcccacaagcatggcatccccgatgagacctgcaacaactaccag
gccaaggaccaagactgtgacaagtttaaccagtgtgggacctgcactgaattcaaagag
tgtcacaccatccagaattacaccctctggagagtgggtgattacggctccctgtccggg
agggagaagatgatggccgagatctatgccaatggtcccatcagctgcgggataatggca
acagagatgatgtctaactacactgggggcatctatgctgagcaccaggaccaggccgtt
atcaaccacatcatctctgtagctggctggggtgtcagcaacgatggcatcgagtactgg
attgtccgaaattcatggggcgaaccctggggtgagaaaggctggatgaggatcgtgacc
agcacctacaagggaggcacaggtgacagctacaaccttgccatcgagagtgcctgcaca
tttggggaccccattgtttag

DBGET integrated database retrieval system