KEGG   Mus musculus (mouse): 64707Help
Entry
64707             CDS       T01002                                 

Gene name
Suv39h2, 4930507K23Rik, AA536750, D030054H19Rik, D2Ertd544e, KMT1B
Definition
(RefSeq) suppressor of variegation 3-9 2
  KO
K11419  histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    64707 (Suv39h2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    64707 (Suv39h2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     64707 (Suv39h2)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     64707 (Suv39h2)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    64707 (Suv39h2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET Pre-SET Chromo
Motif
Other DBs
NCBI-GeneID: 64707
NCBI-ProteinID: NP_073561
MGI: 1890396
Ensembl: ENSMUSG00000026646
Vega: OTTMUSG00000010791
UniProt: Q9EQQ0 A0A0R4J074
LinkDB All DBs
Position
2 A1; 2 1.95 cM
AA seq 477 aa AA seqDB search
MAAARAKARGSEAGARCHRAPGPPPRPKARRTARRRRAETLTARRSRPSAGERRAGSQRA
WSGAPRAAVFGDECARGALFKAWCVPCLVSLDTLQELCRKEKLTCKSIGITKRNLNNYEV
EYLCDYKVAKGVEYYLVKWKGWPDSTNTWEPLRNLRCPQLLRQFSDDKKTYLAQERKCKA
VNSKSLQPAIAEYIVQKAKQRIALQRWQDYLNRRKNHKGMIFVENTVDLEGPPLDFYYIN
EYRPAPGISINSEATFGCSCTDCFFDKCCPAEAGVVLAYNKKQQIKIQPGTPIYECNSRC
RCGPECPNRIVQKGTQYSLCIFRTSNGCGWGVKTLVKIKRMSFVMEYVGEVITSEEAERR
GQFYDNKGITYLFDLDYESDEFTVDAARYGNVSHFVNHSCDPNLQVFSVFIDNLDTRLPR
IALFSTRTINAGEELTFDYQMKGSGEASSDSIDHSPAKKRVRTQCKCGAETCRGYLN
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggccagggccaaggcacggggcagtgaggcaggagcgcggtgtcaccgggct
ccaggtccgcccccgaggcccaaggccaggcgaacggcgagacgccgccgcgcggagacc
ctgacggcgcgacgctcgcggccgtctgcgggcgagaggcgcgccggctcccagcgagcg
tggtccggagctccgcgggccgcggtctttggcgacgagtgtgcacgaggtgccttattc
aaggcctggtgtgtgccttgcctagtttcacttgatactctccaggaattatgtagaaaa
gaaaagctcacatgtaaatcgattggaatcaccaaaaggaatctaaacaattatgaggtg
gagtacttgtgtgactacaaggtagcaaagggtgtggaatattatcttgtaaaatggaaa
ggatggccagattctacaaacacctgggagcccttgagaaacctcaggtgtccacagctc
ctgcggcagttctctgatgacaagaagacttacttagctcaggaaaggaaatgcaaggct
gtcaattcaaaatccttgcaacctgcaattgctgagtatattgtacagaaagctaagcaa
agaatagctctgcagagatggcaagattacctcaacagaagaaagaaccataaggggatg
atatttgttgaaaacactgttgacttggagggcccacctttagacttctactacattaac
gagtacaggccagctcccgggatcagcataaacagtgaagccacctttggatgttcatgt
acagactgcttctttgacaagtgttgtcctgctgaagctggagttgtgttggcttataat
aagaagcaacaaattaaaatccaaccaggcactcccatctacgaatgcaactcaaggtgt
cgatgtggacctgaatgtcccaataggattgtacaaaaaggcacacaatattcactgtgc
atctttagaactagcaatggctgtggttggggtgtaaaaacccttgtgaagattaaaaga
atgagttttgtcatggaatatgttggagaggtgatcacaagtgaagaggccgagagacgg
ggacagttctatgacaacaaagggatcacctacctctttgacctggactacgagtctgat
gagttcacagtggatgcagctcgatatggaaacgtatcccattttgtgaatcatagttgt
gacccaaatcttcaggtgtttagtgttttcatcgataaccttgatactcggctgcccagg
atagcattgttctctacaagaaccataaacgctggagaagagctgacttttgactatcaa
atgaaaggttctggagaagcatcttcagactccattgaccacagccctgccaaaaaaagg
gtcagaacccaatgtaaatgtggagccgagacttgcagaggttacctcaactga

DBGET integrated database retrieval system