KEGG   Mus musculus (mouse): 64930Help
Entry
64930             CDS       T01002                                 

Gene name
Tsc1
Definition
(RefSeq) TSC complex subunit 1
  KO
K07206  tuberous sclerosis 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04072  Phospholipase D signaling pathway
mmu04140  Autophagy - animal
mmu04150  mTOR signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04152  AMPK signaling pathway
mmu04211  Longevity regulating pathway
mmu04218  Cellular senescence
mmu04714  Thermogenesis
mmu04910  Insulin signaling pathway
mmu05163  Human cytomegalovirus infection
mmu05165  Human papillomavirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    64930 (Tsc1)
   04151 PI3K-Akt signaling pathway
    64930 (Tsc1)
   04152 AMPK signaling pathway
    64930 (Tsc1)
   04150 mTOR signaling pathway
    64930 (Tsc1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    64930 (Tsc1)
  09143 Cell growth and death
   04218 Cellular senescence
    64930 (Tsc1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    64930 (Tsc1)
  09149 Aging
   04211 Longevity regulating pathway
    64930 (Tsc1)
  09159 Environmental adaptation
   04714 Thermogenesis
    64930 (Tsc1)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    64930 (Tsc1)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    64930 (Tsc1)
   05163 Human cytomegalovirus infection
    64930 (Tsc1)
   05165 Human papillomavirus infection
    64930 (Tsc1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hamartin zf-C2H2_assoc ATG16
Motif
Other DBs
NCBI-GeneID: 64930
NCBI-ProteinID: NP_001276504
MGI: 1929183
Ensembl: ENSMUSG00000026812
Vega: OTTMUSG00000011747
UniProt: Q9EP53
LinkDB All DBs
Position
2; 2 A3
AA seq 1161 aa AA seqDB search
MAQLANIGELLSMLDSSTLGVRDDVTAIFKESLNSERGPMLVNTLVDYYLETNSQPVLHI
LTTLQEPHDKHLLDKINEYVGKAATRLSILSLLGHVVRLQPSWKHKLSQAPLLPSLLKCL
KMDTDVVVLTTGVLVLITMLPMIPQSGKQHLLDFFDIFGRLSSWCLKKPGHVTEVYLVHL
HASVYALFHRLYGMYPCNFVSFLRSHYSMKENVETFEEVVKPMMEHVRIHPELVTGSKDH
ELDPRRWKTLETHDVVIECAKISLDPTEASYEDGYSVSHQLSACFPYRSADVTTSPYVDT
QNSYGGSTSTPSSSSRLMLFSPPGQLPQSLSSPSTRLLPEPLQASLWSPSAVCGMTTPPT
SPGNVPADLSHPYSKAFGTTAGGKGTPSGTPATSPPPAPPCPQDDCVHGSAAQASATAPR
KEERADSSRPYLHRQSNDRGLEDPPGSKGSVTLRNLPDFLGDLASEEDSIEKDKEEAAIS
KELSEITTAEADPVVPRGGFDSPFYRDSLSGSQRKTHSAASGTQGSSVNPEPLHSSLDKH
GPDTPKQAFTPIDPPSGSADVSPAGDRDRQTSLETSILTPSPCKIPPQRGVSFGSGQLPP
YDHLFEVALPKTACHFVSKKTEELLKKVKGNPEEDCVPSTSPMEVLDRLIEQGAGAHSKE
LSRLSLPSKSVDWTHFGGSPPSDELRTLRDQLLLLHNQLLYERFKRQQHALRNRRLLRKV
IRAAALEEHNAAMKDQLKLQEKDIQMWKVSLQKEQARYSQLQEQRDTMVTQLHSQIRQLQ
HDREEFYNQSQELQTKLEDCRNMIAELRVELKKANNKVCHTELLLSQVSQKLSNSESVQQ
QMEFLNRQLLVLGEVNELYLEQLQSKHPDTTKEVEMMKTAYRKELEKNRSHLLQQNQRLD
ASQRRVLELESLLAKKDHLLLEQKKYLEDVKSQASGQLLAAESRYEAQRKITRVLELEIL
DLYGRLEKDGRLRKLEEDRAEAAEAAEERLDCCSDGCTDSLVGHNEEASGHNGETRTSRP
GGTRASCGGRVTGGSSSSSSELSTPEKPPSQRFSSRWEPALGEPSSSIPTTVGSLPSSKS
FLGMKARELFRNKSESQCDEDSVTMSSSSLSETLKTELGKDSGTENKTSLSLDAPHPSSP
NSDNVGQLHIMDYNETHPEHS
NT seq 3486 nt NT seq  +upstreamnt  +downstreamnt
atggcccagttagccaacattggggagctgctctccatgctggactcctccacactgggt
gtgcgggatgacgtgacagccatcttcaaggagtccctcaattctgaacgtgggcctatg
cttgtcaacacgttggttgattattacctggaaaccaattctcagccggtattgcacatc
ctgaccaccttgcaggagccacacgataagcacctcttggacaaaattaatgagtatgta
ggcaaagctgctacccgtttatccatcctctcgctgctggggcatgttgtgagactgcag
ccatcttggaagcataagctctctcaagcacctcttctgccttctttattgaaatgtctc
aagatggacactgatgttgtggtcctcacaactggtgtcttggtgttgatcaccatgctc
ccgatgatcccgcagtcagggaagcagcaccttctcgacttctttgacatctttggccgt
ctctcgtcatggtgcctgaagaaaccaggccatgtgacagaagtgtacctggtccatctt
catgccagtgtttatgccctctttcaccgcctttatgggatgtacccatgtaacttcgtc
tccttcctgcgctctcactacagtatgaaggaaaacgtggagacttttgaagaagtggtc
aagccaatgatggagcatgtgcgaattcacccggaattagtgactggatccaaggaccat
gaactggaccctcgaaggtggaagacattagaaactcatgatgttgtaatagagtgtgcc
aaaatctctctggaccctacagaagcctcgtatgaagatggctattctgtgtcacaccag
ctctctgcttgcttcccttaccgttcagctgatgtcaccaccagcccttatgtggacaca
cagaatagctatgggggttctacttccaccccttcctccagctctcggctgatgttgttc
agtccacctgggcagctacctcagagtttgagttccccatcaacacggctgttacctgag
ccgctgcaagctagtctctggagcccatctgcggtctgtggtatgaccactcctcctacg
tctcctggaaatgtcccagctgatttgtcacatccgtatagtaaagcctttggtaccact
gcaggtggaaaaggaactccttcaggaaccccagcgacctctcctcctccagccccacct
tgtccccaagatgactgtgtgcatggttcagcagcccaggcctcagccacagcccccagg
aaggaagaaagagcagattcctcaaggccttaccttcacagacagtcaaacgaccgagga
ttagaggatccacctggaagcaaaggttccgttactctgaggaatctacctgatttccta
ggtgatctggcttctgaggaagacagtatcgagaaagataaggaagaagctgcaatatct
aaagagctttctgagatcactactgcagaggcggatcctgtagttcctcgagggggcttt
gactctcccttctaccgagacagtctctctggctctcagcggaagactcattcggcagcc
tctgggactcagggctccagcgtgaaccctgagcctttgcactcctccctggacaaacat
gggcctgacacaccaaagcaagcctttactcccatagacccaccctctggcagtgctgat
gtcagtcccgctggggacagggatcgccagacttctctggagaccagtatcctcactccc
agcccttgcaaaatcccacctcagaggggagtgagctttggaagtgggcagcttccccca
tatgatcatctctttgaggtggccttgccaaagactgcctgtcactttgtcagcaagaag
actgaggagctgttgaagaaagtgaaaggaaaccctgaggaagactgtgtgccctctacc
tccccaatggaagtactggacagactgatagagcagggagcaggtgcgcacagcaaggag
ctgagcaggttgtccctgcccagcaagtctgttgactggacccactttggaggctctcct
ccctcagatgagctccggaccctccgagaccagttgcttttactgcacaatcagctgctg
tacgagcgcttcaagcggcagcagcatgcactcaggaacagaaggctcctgcgcaaggtg
atccgagcagcggctctggaggaacacaatgcagcaatgaaagatcagttgaagttacaa
gagaaggacatacagatgtggaaggtgagtctgcagaaagaacaagcccgatacagtcag
cttcaggaacaacgtgacaccatggtgacccaactgcatagccagatcagacagctacag
catgaccgagaagaattctacaaccagagtcaggagttacagacaaagctggaggactgc
agaaacatgattgcggagcttcgggtggagctgaagaaggctaacaacaaggtgtgccac
actgagctgctgctcagccaggtctctcagaagctctccaacagtgagtcagtgcagcag
cagatggagttcttgaataggcagctcctggtgctcggggaggtcaatgagctgtacctg
gagcagctgcagagcaagcatcctgacaccaccaaggaagtagaaatgatgaaaactgca
tatcggaaagagctagagaaaaacagaagccaccttctccagcagaaccaaaggttggac
gcctcacagaggcgagttttggaactggagtctcttctggccaagaaagaccaccttctc
ctagaacagaagaaatatcttgaggatgtcaagagccaggcgagtggacagctgctggct
gcagagagcaggtatgaggctcagagaaagatcacccgggtgttggaactggagatccta
gacttgtatggcaggttggaaaaagatggccgcctacggaaactagaagaggacagagca
gaggcagcagaggcagcagaagagaggcttgactgttgtagtgatggatgcacagattcc
ttggtaggacataatgaagaggcttctggtcacaatggtgagaccaggacctccagacct
ggtggcacccgggccagctgtggaggtagagtcactggaggcagcagcagcagcagcagt
gagctttccactccagagaaacccccgagccagaggttcagcagccggtgggaacctgcc
ctgggcgagccctccagcagcatccccaccactgttggctcacttcccagttccaaaagc
ttcctgggcatgaaggcccgggagctgttccgtaataagagcgagagccagtgtgatgag
gacagcgtgaccatgagtagcagcagcctttctgagaccctgaagacagaactgggcaag
gactcgggcacagaaaacaagacttccctgagtctagatgccccacacccatcttcccca
aactcagacaatgtggggcagctccacatcatggactacaatgagactcatcctgaacac
agctga

DBGET integrated database retrieval system