KEGG   Mus musculus (mouse): 66350Help
Entry
66350             CDS       T01002                                 

Gene name
Pla2g12a, 2310004B05Rik, GXII, GXII-1, GXII-1-PLA2, Pla2g12, Rossy, mGXII-1
Definition
(RefSeq) phospholipase A2, group XIIA
  KO
K01047  secretory phospholipase A2 [EC:3.1.1.4]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00564  Glycerophospholipid metabolism
mmu00565  Ether lipid metabolism
mmu00590  Arachidonic acid metabolism
mmu00591  Linoleic acid metabolism
mmu00592  alpha-Linolenic acid metabolism
mmu01100  Metabolic pathways
mmu04014  Ras signaling pathway
mmu04270  Vascular smooth muscle contraction
mmu04972  Pancreatic secretion
mmu04975  Fat digestion and absorption
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    66350 (Pla2g12a)
   00565 Ether lipid metabolism
    66350 (Pla2g12a)
   00590 Arachidonic acid metabolism
    66350 (Pla2g12a)
   00591 Linoleic acid metabolism
    66350 (Pla2g12a)
   00592 alpha-Linolenic acid metabolism
    66350 (Pla2g12a)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    66350 (Pla2g12a)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    66350 (Pla2g12a)
  09154 Digestive system
   04972 Pancreatic secretion
    66350 (Pla2g12a)
   04975 Fat digestion and absorption
    66350 (Pla2g12a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    66350 (Pla2g12a)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     66350 (Pla2g12a)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    66350 (Pla2g12a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2G12
Motif
Other DBs
NCBI-GeneID: 66350
NCBI-ProteinID: NP_075685
MGI: 1913600
Ensembl: ENSMUSG00000027999
Vega: OTTMUSG00000054638
UniProt: Q9EPR2
LinkDB All DBs
Position
3; 3 G3
AA seq 192 aa AA seqDB search
MVTPRPAPARSPALLLLLLLATARGQEQDQTTDWRATLKTIRNGIHKIDTYLNAALDLLG
GEDGLCQYKCSDGSKPVPRYGYKPSPPNGCGSPLFGVHLNIGIPSLTKCCNQHDRCYETC
GKSKNDCDEEFQYCLSKICRDVQKTLGLSQNVQACETTVELLFDSVIHLGCKPYLDSQRA
ACWCRYEEKTDL
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atggtgactccgcggcccgcgcccgcccggagccccgcgctcctcctcctcctgctgctg
gccactgcgcgtgggcaggaacaggaccagaccaccgactggagggccaccctcaagacc
atccgcaacggcatccacaagatagacacgtacctcaacgccgcgctggacctgctgggc
ggggaggacgggctctgccagtacaagtgcagcgacggatcgaagcctgttccacgctat
ggatataaaccatctccaccaaatggctgtggctcgccactgtttggcgttcatctgaac
ataggtatcccttccctgaccaagtgctgcaaccagcacgacagatgctacgagacctgc
gggaaaagcaagaacgactgtgacgaggagttccagtactgcctctccaagatctgcaga
gacgtgcagaagacgctcggactatctcagaacgtccaggcatgtgagacaacggtggag
ctcctctttgacagcgtcatccatttaggctgcaagccatacctggacagccagcgggct
gcatgctggtgtcgttatgaagaaaaaacagatctataa

DBGET integrated database retrieval system