KEGG   Mus musculus (mouse): 66408Help
Entry
66408             CDS       T01002                                 

Gene name
Aptx, 2410016G21Rik, AA388047, FHA-HIT
Definition
(RefSeq) aprataxin
  KO
K10863  aprataxin [EC:3.1.11.7 3.1.11.8 3.1.12.2]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mmu03400]
    66408 (Aptx)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.7  adenosine-5'-diphospho-5'-[DNA] diphosphatase
     66408 (Aptx)
    3.1.11.8  guanosine-5'-diphospho-5'-[DNA] diphosphatase
     66408 (Aptx)
   3.1.12  Exodeoxyribonucleases producing 3'-phosphomonoesters
    3.1.12.2  DNA-3'-diphospho-5'-guanosine diphosphatase
     66408 (Aptx)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Other BER factors
     66408 (Aptx)
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Other NHEJ factors
     66408 (Aptx)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FHA_2 DcpS_C HIT zf-C2HE FHA Glycoamylase zf-C2H2_6
Motif
Other DBs
NCBI-GeneID: 66408
NCBI-ProteinID: NP_079821
MGI: 1913658
Ensembl: ENSMUSG00000028411
Vega: OTTMUSG00000006564
UniProt: Q7TQC5
LinkDB All DBs
Position
4; 4 A5
AA seq 342 aa AA seqDB search
MPEAVAKMRVCWLVRQDSRHQRIKLPHLEAVVIGRSPETKITDKKCSRQQVQLKAECNKG
YVKVQQMGVNPTSIDSGVIGKDQEKKLLPGQVLHMVNGLYPYIVEFEEVAESPNLTQRKR
KRSDCDSEEMEAESGTGLAPGSSPSQCSVSPKKDKNGATKKESLGHWSQGLKMSMKDPKM
QVYKDDQVVVIKDKYPKARHHWLVLPWASISSLKVVTSEHLELLKHMHAVGEKVIADFAG
SSKLRFRLGYHAIPSMSHVHLHVISQDFDSPCLKNKKHWNSFNTEYFLESQAVIKMVQEA
GRVTVKDGTCELLKLPLRCHECQQLLPSIPQLKEHLRKHWGG
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgccggaagcagtagctaagatgcgagtgtgctggttggtgagacaggacagcaggcac
cagcgaatcaaacttccccatttggaagctgttgtgattggtcgaagcccagagaccaag
atcacagataagaaatgttcccgacagcaagtacagttgaaagcagagtgtaacaaggga
tatgtcaaagtacagcagatgggggtcaaccccaccagcattgactcgggcgtcatcggg
aaggaccaagagaagaagctgctgcctggtcaggttctccacatggtgaatggactttat
ccatacatcgtagagtttgaggaagtggcagagagccctaacctaacacagaggaagaga
aagaggtcagactgtgatagtgaggagatggaagctgagtctgggacagggctggcacct
gggagcagccccagccagtgctctgtgtcccctaagaaggacaagaatggagccaccaaa
aaggaatcactgggccactggagtcaaggcttgaagatgtctatgaaagaccccaaaatg
caggtttacaaagacgaccaggtggtggtgattaaggataaataccccaaggcccgtcac
cactggctggtcttaccgtgggcctccatttccagtctgaaggttgtgaccagtgaacac
cttgaacttctcaaacatatgcacgctgtgggggagaaggtgatagcagattttgctgga
tccagcaaactgcgcttccgattgggctaccatgccattcccagcatgagccacgtacat
cttcatgtgatcagccaggattttgattctccttgccttaaaaacaaaaagcattggaat
tcttttaatacagaatactttctggaatcacaagctgtgatcaagatggttcaggaagcc
ggcagagtgactgttaaagatggcacttgtgagctcttgaagctgcctctccgttgccat
gagtgtcagcagctgctgccttccatcccgcagctgaaagagcacctcaggaagcactgg
ggcgggtga

DBGET integrated database retrieval system