KEGG   Mus musculus (mouse): 66447Help
Entry
66447             CDS       T01002                                 

Gene name
Mgst3, 2010012L10Rik, 2010306B17Rik, 2700004G04Rik, AA516734, GST-III
Definition
(RefSeq) microsomal glutathione S-transferase 3
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00480  Glutathione metabolism
mmu00980  Metabolism of xenobiotics by cytochrome P450
mmu00982  Drug metabolism - cytochrome P450
mmu00983  Drug metabolism - other enzymes
mmu01524  Platinum drug resistance
mmu05200  Pathways in cancer
mmu05204  Chemical carcinogenesis
mmu05225  Hepatocellular carcinoma
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    66447 (Mgst3)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    66447 (Mgst3)
   00982 Drug metabolism - cytochrome P450
    66447 (Mgst3)
   00983 Drug metabolism - other enzymes
    66447 (Mgst3)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    66447 (Mgst3)
   05204 Chemical carcinogenesis
    66447 (Mgst3)
  09162 Cancers: Specific types
   05225 Hepatocellular carcinoma
    66447 (Mgst3)
  09166 Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    66447 (Mgst3)
  09176 Drug resistance: Antineoplastic
   01524 Platinum drug resistance
    66447 (Mgst3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    66447 (Mgst3)
Enzymes [BR:mmu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     66447 (Mgst3)
Transporters [BR:mmu02000]
 Other Transporters
  Pores ion channels [TC:1]
   66447 (Mgst3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MAPEG
Motif
Other DBs
NCBI-GeneID: 66447
NCBI-ProteinID: NP_079845
MGI: 1913697
Ensembl: ENSMUSG00000026688
Vega: OTTMUSG00000022623
UniProt: Q9CPU4
LinkDB All DBs
Position
1; 1 H2.3
AA seq 153 aa AA seqDB search
MAVLSKEYGFVLLTGAASFVMVLHLAINVGKARKKYKVEYPVMYSTDPENGHMFNCIQRA
HQNTLEVYPPFLFFLTVGGVYHPRIASGLGLAWIIGRVLYAYGYYTGDPSKRYRGAVGSL
ALFALMGTTVCSAFQHLGWIRPGLGYGSRSCHH
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atggctgtcctctctaaggagtatggatttgtgcttctcactggtgctgccagctttgtg
atggtgctccacctagccatcaacgtgggcaaagcccgcaagaagtacaaggtagagtac
cctgtcatgtacagcacagatcctgagaacgggcatatgttcaactgcattcagcgcgcc
caccagaacacgttggaggtgtaccctcccttcctgtttttcctaacggtgggaggtgtt
taccacccgcgcatagcttctggcctgggcctggcctggattattgggcgagtcctttac
gcatatggctactacacaggagaccctagcaagcggtatcgaggagccgtgggctctctt
gccctctttgccctgatgggcaccaccgtgtgctctgctttccagcatctcggctggatc
agaccaggcttaggctacgggtccagatcctgccaccactga

DBGET integrated database retrieval system