KEGG   Mus musculus (mouse): 66447Help
Entry
66447             CDS       T01002                                 

Gene name
Mgst3, 2010012L10Rik, 2010306B17Rik, 2700004G04Rik, AA516734, GST-III
Definition
(RefSeq) microsomal glutathione S-transferase 3
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00480  Glutathione metabolism
mmu00980  Metabolism of xenobiotics by cytochrome P450
mmu00982  Drug metabolism - cytochrome P450
mmu00983  Drug metabolism - other enzymes
mmu01524  Platinum drug resistance
mmu05200  Pathways in cancer
mmu05204  Chemical carcinogenesis
mmu05225  Hepatocellular carcinoma
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    66447 (Mgst3)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    66447 (Mgst3)
   00982 Drug metabolism - cytochrome P450
    66447 (Mgst3)
   00983 Drug metabolism - other enzymes
    66447 (Mgst3)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    66447 (Mgst3)
   05204 Chemical carcinogenesis
    66447 (Mgst3)
   05225 Hepatocellular carcinoma
    66447 (Mgst3)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    66447 (Mgst3)
  Drug resistance
   01524 Platinum drug resistance
    66447 (Mgst3)
Enzymes [BR:mmu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     66447 (Mgst3)
Transporters [BR:mmu02000]
 Other Transporters
  Pores ion channels [TC:1]
   66447 (Mgst3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MAPEG
Motif
Other DBs
NCBI-GeneID: 66447
NCBI-ProteinID: NP_079845
MGI: 1913697
Ensembl: ENSMUSG00000026688
Vega: OTTMUSG00000022623
UniProt: Q9CPU4
LinkDB All DBs
Position
1; 1 H2.3
AA seq 153 aa AA seqDB search
MAVLSKEYGFVLLTGAASFVMVLHLAINVGKARKKYKVEYPVMYSTDPENGHMFNCIQRA
HQNTLEVYPPFLFFLTVGGVYHPRIASGLGLAWIIGRVLYAYGYYTGDPSKRYRGAVGSL
ALFALMGTTVCSAFQHLGWIRPGLGYGSRSCHH
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atggctgtcctctctaaggagtatggatttgtgcttctcactggtgctgccagctttgtg
atggtgctccacctagccatcaacgtgggcaaagcccgcaagaagtacaaggtagagtac
cctgtcatgtacagcacagatcctgagaacgggcatatgttcaactgcattcagcgcgcc
caccagaacacgttggaggtgtaccctcccttcctgtttttcctaacggtgggaggtgtt
taccacccgcgcatagcttctggcctgggcctggcctggattattgggcgagtcctttac
gcatatggctactacacaggagaccctagcaagcggtatcgaggagccgtgggctctctt
gccctctttgccctgatgggcaccaccgtgtgctctgctttccagcatctcggctggatc
agaccaggcttaggctacgggtccagatcctgccaccactga

DBGET integrated database retrieval system