KEGG   Mus musculus (mouse): 66922Help
Entry
66922             CDS       T01002                                 

Gene name
Rras2, 2610016H24Rik, C86394, TC21
Definition
(RefSeq) related RAS viral (r-ras) oncogene 2
  KO
K07830  Ras-related protein R-Ras2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04024  cAMP signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04137  Mitophagy - animal
mmu04140  Autophagy - animal
mmu04218  Cellular senescence
mmu04371  Apelin signaling pathway
mmu04625  C-type lectin receptor signaling pathway
mmu04810  Regulation of actin cytoskeleton
mmu05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    66922 (Rras2)
   04010 MAPK signaling pathway
    66922 (Rras2)
   04371 Apelin signaling pathway
    66922 (Rras2)
   04072 Phospholipase D signaling pathway
    66922 (Rras2)
   04024 cAMP signaling pathway
    66922 (Rras2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    66922 (Rras2)
   04137 Mitophagy - animal
    66922 (Rras2)
  09143 Cell growth and death
   04218 Cellular senescence
    66922 (Rras2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    66922 (Rras2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    66922 (Rras2)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    66922 (Rras2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    66922 (Rras2)
   04031 GTP-binding proteins [BR:mmu04031]
    66922 (Rras2)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   66922 (Rras2)
  Exosomal proteins of bladder cancer cells
   66922 (Rras2)
GTP-binding proteins [BR:mmu04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    66922 (Rras2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase ATP_bind_1 DUF2075
Motif
Other DBs
NCBI-GeneID: 66922
NCBI-ProteinID: NP_080122
MGI: 1914172
Ensembl: ENSMUSG00000055723
Vega: OTTMUSG00000060367
UniProt: P62071 Q9CTF6
LinkDB All DBs
Position
7; 7 F1
AA seq 204 aa AA seqDB search
MAAAGWRDGSGQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDDR
AARLDILDTAGQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEF
PMILIGNKADLDHQRQVTQEEGQQLARQLKVTYMEASAKIRMNVDQAFHELVRVIRKFQE
QECPPSPEPTRKEKDKKGCHCVIF
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atggccgcggccggctggcgcgacggctccggccaggagaagtaccggctcgtggtggtc
ggcggtggcggcgtgggcaagtcggcgctcaccatccagttcatccagtcctattttgtg
acggactatgatccaaccattgaagactcatacacaaagcaatgtgtgatcgatgaccga
gctgcccggctggacattttggatacagccggacaagaggagtttggagccatgagagag
caatacatgaggacaggcgagggcttcctgttggtcttctcagtcacggatagaggcagt
tttgaagaaatctataagtttcaaagacagattctcagagtaaaggaccgtgatgagttt
cccatgattttaattggcaataaagctgacctggaccatcagagacaggtaacacaggaa
gaagggcagcagttagcaaggcagctcaaggtcacatatatggaggcatcggcaaagatc
aggatgaatgtagaccaagctttccacgaacttgtccgggttataaggaaatttcaagag
caagaatgccctccttcaccagaaccaacccggaaagaaaaagacaagaaaggctgccat
tgtgtcattttctaa

DBGET integrated database retrieval system