KEGG   Mus musculus (mouse): 66945Help
Entry
66945             CDS       T01002                                 

Gene name
Sdha, 1500032O14Rik, 2310034D06Rik, 4921513A11, C81073, FP, SDH2, SDHF
Definition
(RefSeq) succinate dehydrogenase complex, subunit A, flavoprotein (Fp)
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00020  Citrate cycle (TCA cycle)
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu01200  Carbon metabolism
mmu04714  Thermogenesis
mmu04932  Non-alcoholic fatty liver disease (NAFLD)
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05016  Huntington disease
Module
mmu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mmu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mmu_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    66945 (Sdha)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    66945 (Sdha)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    66945 (Sdha)
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05010 Alzheimer disease
    66945 (Sdha)
   05012 Parkinson disease
    66945 (Sdha)
   05016 Huntington disease
    66945 (Sdha)
  09166 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    66945 (Sdha)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     66945 (Sdha)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Thi4 Pyr_redox_2 GIDA FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 66945
NCBI-ProteinID: NP_075770
MGI: 1914195
Ensembl: ENSMUSG00000021577
Vega: OTTMUSG00000030724
UniProt: Q8K2B3
LinkDB All DBs
Position
13; 13 C1
AA seq 664 aa AA seqDB search
MAGVGAVSRLLRGRRLALTGAWPGTLQKQTCGFHFSVGENKKASAKVSDAISTQYPVVDH
EFDAVVVGAGGAGLRAAFGLSEAGFNTACLTKLFPTRSHTVAAQGGINAALGNMEEDNWR
WHFYDTVKGSDWLGDQDAIHYMTEQAPASVVELENYGMPFSRTEDGKIYQRAFGGQSLKF
GKGGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMENGECRGVIALCIE
DGSIHRIRAKNTVIATGGYGRTYFSCTSAHTSTGDGTAMVTRAGLPCQDLEFVQFHPTGI
YGAGCLITEGCRGEGGILINSQGERFMERYAPVAKDLASRDVVSRSMTLEIREGRGCGPE
KDHVYLQLHHLPPEQLATRLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGIPTNYKGQ
VLKHVNGQDQIVPGLYACGEAACASVHGANRLGANSLLDLVVFGRACALSIAESCRPGDK
VPSIKANAGEESVMNLDKLRFADGSIRTSELRLNMQKSMQNHAAVFRVGSVLQEGCEKIS
QLYGDLKHLKTFDRGMVWNTDLVETLELQNLMLCALQTIYGAEARKESRGAHAREDYKVR
VDEYDYSKPIQGQQKKPFGEHWRKHTLSYVDIKTGKVTLEYRPVIDKTLNEADCATVPPA
IRSY
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atggccggggttggcgcagtttcgaggcttcttcgcgggcggcgcttggcgttaactggg
gcgtggccaggaacactccaaaaacagacctgcggctttcacttctctgttggtgagaac
aagaaggcatcagctaaagtttcagatgcaatttctactcaatacccagtggtggatcat
gaatttgatgctgtggttgtaggcgctggaggggcaggcttgcgagctgcatttggcctt
tctgaggcagggtttaatactgcatgccttacaaagctctttcctacccgatcacatact
gttgcagcacagggaggtatcaatgctgctctggggaacatggaagaggacaactggaga
tggcatttctatgacactgtgaaaggctccgactggctgggggatcaggatgccatccat
tacatgacagagcaagctcctgcctctgtggttgagctagaaaattatggtatgccattt
agcagaactgaagatgggaagatttatcagcgtgcatttggtggacagagcctcaagttt
gggaaaggcgggcaggctcatcggtgttgctgtgtggctgatcggacaggccactcactc
ttacacacgttgtatggaagatctctgcgatatgacaccagttattttgtggaatatttt
gcactggatcttctgatggaaaatggggagtgccgtggtgtcattgcactgtgcatagaa
gatgggtccatacaccgaataagagcaaaaaacactgttattgctactgggggctacggg
cgaacctacttcagctgtacatctgcccataccagcacaggggacggcacagccatggtc
actagggctggtttgccttgccaggacttagaatttgttcagttccaccccacaggtata
tacggtgctggctgcctcatcacagaagggtgtcgtggagagggggggattctcatcaac
agtcaaggtgaaaggttcatggagagatacgcacctgttgccaaggacctggcatcaaga
gatgttgtgtctcgatccatgactcttgagatccgtgaaggaagaggctgtggccctgag
aaagatcacgtctacctgcagttgcatcatctgcctcctgagcaactggccacacgtcta
cccggaatttcagagacggccatgatcttcgctggtgtggatgtcactaaggagcccatc
ccagtcctccccactgtgcattacaacatgggtgggattcccactaactacaagggacag
gtgctgaagcatgtgaatggccaggatcagattgtgcctggtctgtatgcctgtggggag
gctgcctgcgcctcagtgcatggtgccaaccggcttggagcaaattctctcttggacctt
gtagtctttggcagagcctgtgccctgagcattgcagaatcttgcaggcctggagataaa
gttccttcaattaaggcaaatgctggagaagaatcggttatgaatcttgacaagttgaga
tttgccgatggaagtataagaacatcagaactacgcctaaacatgcagaagtcgatgcag
aaccatgctgcagtgttccgtgtggggagtgtattgcaagaaggctgtgaaaaaatcagt
cagctctatggagacctaaagcatctaaagacattcgacaggggaatggtttggaacaca
gacctggtggagaccctggagctgcagaatctgatgctgtgcgcactgcagaccatatat
ggtgcagaagctcggaaggagtcccggggagcccatgccagggaagattacaaagtgcgg
gtcgatgagtatgattactccaagcccatccagggacagcagaagaagccgtttggggaa
cactggaggaagcacaccctctcatatgtggacatcaagactggcaaggttactttggag
tacagacctgttatcgacaagaccttgaatgaggctgactgtgccaccgtacctcctgct
atccgctcctactga

DBGET integrated database retrieval system