KEGG   Mus musculus (mouse): 67680Help
Entry
67680             CDS       T01002                                 

Gene name
Sdhb, 0710008N11Rik
Definition
(RefSeq) succinate dehydrogenase complex, subunit B, iron sulfur (Ip)
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00020  Citrate cycle (TCA cycle)
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu01200  Carbon metabolism
mmu04714  Thermogenesis
mmu04932  Non-alcoholic fatty liver disease (NAFLD)
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05016  Huntington disease
Module
mmu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mmu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mmu_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    67680 (Sdhb)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    67680 (Sdhb)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    67680 (Sdhb)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05010 Alzheimer disease
    67680 (Sdhb)
   05012 Parkinson disease
    67680 (Sdhb)
   05016 Huntington disease
    67680 (Sdhb)
  09167 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    67680 (Sdhb)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     67680 (Sdhb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer2 Fer4_9 Fer4_18 Fer4_7
Motif
Other DBs
NCBI-GeneID: 67680
NCBI-ProteinID: NP_075863
MGI: 1914930
Ensembl: ENSMUSG00000009863
Vega: OTTMUSG00000010087
UniProt: Q9CQA3
LinkDB All DBs
Position
4; 4 D3
AA seq 282 aa AA seqDB search
MAATVGVSLKRGFPAAVLGRVGLQFQACRGAQTAAAAAPRIKKFAIYRWDPDKTGDKPRM
QTYEVDLNKCGPMVLDALIKIKNEVDSTLTFRRSCREGICGSCAMNINGGNTLACTRRID
TDLSKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEDRE
KLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPF
SVYRCHTIMNCTQTCPKGLNPGKAIAEIKKMMATYKEKRALA
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgacggtcggggtctccttgaagcgcggcttcccggctgccgttctcggcaga
gtcggcctgcagtttcaggcctgtcgaggggcacagacagctgctgctgcagctcccaga
atcaaaaaatttgccatttaccgatgggacccagacaagactggagataaacctcgaatg
cagacgtacgaggtggatctgaataagtgcggacctatggtgttggatgctttaatcaag
atcaagaatgaagtggattctactttaaccttccgaagatcttgtagagaaggcatctgt
ggctcttgcgccatgaacatcaacggaggcaatactctggcgtgcacacgcaggatcgac
acggacctcagcaaagtctccaaaatctaccctcttccacatatgtatgtgatcaaggat
ctagtccctgatttgagtaacttctacgcacaatacaaatccattgagccttatctgaag
aagaaggatgagtcccaggagggcaagcaacagtatctgcagtccatcgaggaccgggag
aagctggacgggctgtacgagtgcatcctgtgtgcctgctgcagcaccagctgccccagc
tactggtggaacggagacaagtacctggggcctgcagttctcatgcaggcctatcgctgg
atgatcgactccagagacgacttcacagaggaacgcctggccaagctgcaggaccccttc
tctgtctaccgctgccacaccatcatgaactgcacacagacctgccccaagggtctgaat
ccggggaaagcgattgcggaaatcaagaagatgatggcgacctacaaggagaagcgagca
ttggcttaa

DBGET integrated database retrieval system