KEGG   Mus musculus (mouse): 67923Help
Entry
67923             CDS       T01002                                 

Gene name
Eloc, 2610043E24Rik, 2610301I15Rik, AA407206, AI987979, AW049146, Tceb1
Definition
(RefSeq) elongin C
  KO
K03872  elongin-C
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04066  HIF-1 signaling pathway
mmu04120  Ubiquitin mediated proteolysis
mmu05170  Human immunodeficiency virus 1 infection
mmu05200  Pathways in cancer
mmu05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    67923 (Eloc)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    67923 (Eloc)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    67923 (Eloc)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    67923 (Eloc)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    67923 (Eloc)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    67923 (Eloc)
   03400 DNA repair and recombination proteins [BR:mmu03400]
    67923 (Eloc)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECV complex
    Adoptor protein
     67923 (Eloc)
   ECS complex
     67923 (Eloc)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     67923 (Eloc)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Skp1_POZ PTAC
Motif
Other DBs
NCBI-GeneID: 67923
NCBI-ProteinID: NP_080732
MGI: 1915173
Ensembl: ENSMUSG00000079658
Vega: OTTMUSG00000048076
UniProt: P83940
LinkDB All DBs
Structure
PDB: 

Position
1; 1 A3
AA seq 112 aa AA seqDB search
MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEV
NFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
atggatggagaggagaagacctatggtggctgtgaaggccctgatgctatgtatgtgaaa
ttaatatcttctgatggccatgaatttattgtaaaaagagaacatgcactaacatcagga
acaataaaggctatgttgagtggtccaggtcagtttgctgagaatgaaaccaacgaggtc
aattttagagagatcccctcacatgtgctatcaaaagtgtgcatgtattttacctacaag
gtccgctatactaacagctccactgaaattcctgaattcccaattgcacctgaaattgca
ctggaactgctgatggctgcaaacttcctagattgttaa

DBGET integrated database retrieval system