KEGG   Mus musculus (mouse): 69051Help
Entry
69051             CDS       T01002                                 

Gene name
Pycr2, 1810018M05Rik, P5cr2
Definition
(RefSeq) pyrroline-5-carboxylate reductase family, member 2
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00330  Arginine and proline metabolism
mmu01100  Metabolic pathways
mmu01230  Biosynthesis of amino acids
Module
mmu_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    69051 (Pycr2)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     69051 (Pycr2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: P5CR_dimer F420_oxidored Rossmann-like NAD_Gly3P_dh_N ApbA
Motif
Other DBs
NCBI-GeneID: 69051
NCBI-ProteinID: NP_598466
MGI: 1277956
Ensembl: ENSMUSG00000026520
Vega: OTTMUSG00000050459
UniProt: Q922Q4 Q3TMZ1
LinkDB All DBs
Position
1; 1 H4
AA seq 320 aa AA seqDB search
MSVGFIGAGQLACALARGFTAAGVLSAHKIIASSPDMDLPTVSALRRMGVNLTRSNKDTV
RHSDVLFLAVKPHIIPFILDEIGADVQERHIVVSCAAGVTISSVEKKLMAFQPAPKVIRC
MTNTPVVVREGATVYATGTHALVEDGKLLEQLMSSVGFCTEVEEDLIDAITGLSGSGPAY
AFMALDALADGGVKMGVPRRLAVRLGAQALLGAAKMLLDSEDHPGQLKDNVCSPGGATIH
ALHFLESGGFRSLLINAVEASCIRTRELQSMADQEKVSPAALKKTLLDRVKLESPTVSTL
APPSSGKLLTRNPAQGSKKE
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtgggtttcatcggcgcaggccagctggcctgtgctctggcgcggggcttcacg
gccgcgggcgtcctgtcggctcacaagataatagccagctccccggatatggacctgccc
acggtgtctgcgctcaggaggatgggtgtgaatctgacccgaagcaataaggacactgtg
cggcacagcgacgtcctgttcctggctgtgaagccccacatcatccccttcatcctggat
gagattggagccgacgtgcaggagaggcacatcgtggtctcctgtgcagccggggtcacc
atcagttctgtggagaagaagctgatggctttccagccggcccccaaagtgatccgctgc
atgaccaacacgcccgtggtggtccgagagggggccaccgtgtatgccacgggcacccat
gctctggtggaagacggcaagcttttggagcagctgatgagcagtgtgggcttctgcaca
gaggtggaggaagacctcattgatgctatcaccgggctcagcggcagcgggcctgcctat
gcattcatggccctggacgccctggcagatggtggggtgaagatgggcgtgccgcggcgc
ctggcggtcagactgggagctcaggcgttgctgggagcagctaagatgctgctggactca
gaggaccatccaggccagctcaaggacaacgtctgctcccctgggggggccaccatccat
gccctgcacttcctggagagtgggggcttccgctctctgctcatcaatgcggttgaggcc
tcctgtatccgaaccagagaactgcagtccatggctgaccaagaaaaggtgtctcctgct
gcccttaagaagacccttctggacagagtgaagctggagtcacccacggtgtccacgctg
gccccacccagctcagggaaactccttacaagaaaccccgcccagggaagcaagaaggag
tga

DBGET integrated database retrieval system